Recombined Template REC-0-8_002

Consensus Sequence

DINVMTQTPKSLPVTPGEPASISLRSNTSLLDSDDGNTYLDWYQKQKPGQSPQLLIYQASTRASGVPDRFSGSGYGTDFTFTISPVQAEDLAVYECHQDYSSPLTFGAGTKLEIKGNPKEAAPSVFLFPPSDPALQPALQPVLSGLLSWTYPGAVTVAWKADGSPVVVAGEFDQGSKSSNQKLGASSYLSLTPEQWKSGFSYSCRVTHEGSTVEKSTAANAKT

Annotated Consensus Sequence

ConsensusTemplate

N.N

KLK

LCL

NTSQNT

CDR1SS

QLQ

K.K

QTQ

CDR2ALA

TYT

YSY

FLF

TKT

PRP

QEQ

LVL

AGA

EYE

HMH

CDR3QQ

DRD

YIY

SES

SFS

AGA

LVL

NQN

E.E

FTF

DSD

PEP

AEA

P.P

LNL

QKQ

PAP

VTV

SVS

GCG

LVL

WDW

TFT

VKV

AGA

GVG

FTF

DTD

QKQ

GPG

SQS

QNQ

LYL

GAG

GHG

FRF

STS

TVT

APA

NAN

AEA

KCK

TST

Legend

CDRConservedPossible glycosylation site

Sequence Consensus Overview

NVM

CLQ

VQALK

LTFSLS

FLA

FSLVNP

RAGSV

VDLPT

TNFGKASP

CPLG

LQE

LEP

VTS

PTS

PNCGL

DTGLR

DTVS

GEQTNSNT

GGALEPQA

KNTS

GSKL

NSKED

NELS

PFGVNED

QLTSWD

LVSEFKRG

TSRLFKDN

KAYPT

WLRY

YVL

AND

AMW

YQKPQ

LAKA

SGQGAN

LAQA

PQY

GSQ

PSTS

SLDTA

DAGPSR

KFLA

VATS

TSV

ALD

GRFR

LKSPYFA

VAESGS

APLSGA

EVFTRS

RVLSG

QGVY

FPAGSAAS

PDSTDTA

MWFDA

KAPRQLF

EAVT

QYGL

NLSARP

RDVDL

DNTQA

TSE

TVGA

GHAV

FANPY

NSAYFGE

NAEC

DFMH

YFDEQ

TYVAVHNSD

ASLY

PNYES

RLFS

QAP

DLT

RTAA

SQT

TKSAGNA

LADSETQNA

KNDQLAVP

SLKGTVEKASV

STPALVEAEA

VLAP

QSVD

QEP

QEA

KPQ

NVPLA

KPAL

ALQ

WGLQA

VEGDW

YGVFLT

GLVDAYPY

AGQ

SVRHAA

AVTSL

AVA

LVSQNA

SDPGW

TPEK

TFA

EPSTLAD

AQTFEKG

TKPGS

NSDP

PKV

DGA

LVG

QCYE

QLTF

ATD

LKQ

TPSG

RTS

EDQTS

TKS

TDLN

DPQ

RGK

PYL

LAG

NLS

DSPQY

HNL

TES

MGL

GPLDT

HANDLP

ALNE

EGLNQ

QVYGDSW

LGTYS

HQVGS

VGLGF

SLPY

TKNS

LMVGC

MVETQR

WLSH

KSQLFE

HEG

LFPS

EKFVT

AESV

QESGL

QKA

DTSVT

VLSTA

0		1	0	D	1	2.9627
1	W	1	0.91569	F	1	0.97835	L	1	18.13084249747475
2		0	11	A	1	1	N	1	14
3	S	1	0.92563	L	1	1.4745300000000001	V	1	20.413578570707074
4		1	0	S	1	0	A	1	0.85025	C	1	0.99891	L	1	0.99947	N	1	1.1414499999999999	V	1	2.99047	M	1	12.092253183080805	TM	2	0.923395
5		1	0	G	1	0.5833118749999999	Q	1	0.76317	D	1	0.94015	S	1	0.96061	N	1	1.39829	T	1	20.265028984848488
6	N	1	0		1	0	V	1	0.19295	M	1	0.46387	P	1	0.5473	H	1	0.63732	E	1	0.69113	C	1	0.98799	L	1	1.8251144444444445	Q	1	13.504336173881676
7		1	0	D	1	0	L	1	0.20991	C	1	0.64848	Q	1	0.99235	S	1	0.99849	H	1	0.99999	V	1	1.10792375	T	1	22.825480751082246
8		1	0	T	1	0	A	1	0.27647	M	1	0.47422	V	1	0.65324	L	1	0.6582	Q	1	2.1939279166666665	P	1	29.432258225843608
9		1	0	N	1	0.86611	G	1	0.99165	H	1	0.99988	V	1	1.95044	Q	1	2.0229060416666664	A	1	3.70606	L	1	9.472095461538462	K	1	16.671976879329005	VT	2	0.7688466666666667
10	V	1	0	K	1	0.60405	R	1	0.65741	L	1	3.2834043333333334	T	1	5.079646458333334	F	1	5.548710922619048	S	1	8.459113333333333	LS	2	2.3421167307692308
11	G	1	0	V	1	0	D	1	0.6074066666666667	Q	1	0.8871	C	1	0.98885	S	1	0.99896	F	1	2.07343	L	1	19.47108752579365
12	D	1	0.181	T	1	0.66552	A	1	0.97075	Q	1	1	F	1	1.8694799999999998	S	1	1.88009	L	1	2.2608575	V	1	2.28531	N	1	3.817836025641025	P	1	10.396373333333331
13		1	0	Q	1	0.07396	K	1	0.5465	Y	1	0.99926	N	1	0.99969	D	1	1	T	1	1.0507044230769231	R	1	1.96	A	1	1.9912	G	1	2.215	S	1	3.0648116666666665	V	1	7.4587699999999995
14		1	0	S	1	0.98677	N	1	0.9954	F	1	0.99903	A	1	0.99995	V	1	1.3332733333333333	D	1	1.671316346153846	L	1	1.96989	P	1	2.8080600000000002	T	1	9.515928333333331
15		1	0	L	1	0	E	1	0.04548	T	1	0.90026	N	1	0.99497	F	1	0.99998	G	1	1.06314	K	1	1.9377766666666667	A	1	2.2483633333333333	S	1	2.3291566666666665	P	1	7.090725769230769
16		1	0	N	1	0	A	1	0.61664	Q	1	0.85065	D	1	0.8745	T	1	0.95381	C	1	0.99997	P	1	1.9578666666666669	L	1	2.55093	G	1	11.110400256410257
17		1	0	M	1	0.07692	R	1	0.09294	V	1	0.6149966666666667	A	1	0.98569	P	1	0.99935	F	1	1	K	1	1.09945	S	1	1.3106866666666666	L	1	1.99018	Q	1	2.9685598076923077	E	1	15.733060965201467
18		1	0	Q	1	0.95448	Y	1	0.9793583333333333	F	1	1.2776933333333333	L	1	1.7961390000000002	E	1	2.7437300000000002	P	1	19.937340465201466
19		1	0	P	1	0.33333	S	1	0.85958	L	1	0.99999	V	1	1.3297566666666667	D	1	1.5643233333333333	A	1	29.247767377289367
20	Q	1	0.3283933333333333	E	1	0.61037	K	1	0.666015	M	1	1.38398	L	1	1.98935	V	1	2.92891	T	1	15.339225959706956	S	1	16.528029551282046	TV	2	0.26069166666666665	LS	2	0.84503
21	Q	1	0	T	1	0.98236	N	1	0.99944	V	1	0.99944	P	1	0.99992	G	1	11.723389489010989	L	1	24.009019884615384	VT	2	0.91188
22	L	1	0.33332666666666666	R	1	0.80049	N	1	0.93938	E	1	0.97556	V	1	1.30447	P	1	8.342933846153846	T	1	12.214587446886444	S	1	13.084968666666667
23		1	0	S	1	0	V	1	0	Y	1	0	W	1	0.3327	E	1	0.39071	Q	1	0.8602038095238094	M	1	0.98452	D	1	1.07867	F	1	1.5248599999999999	P	1	1.99989	N	1	2.5628100000000003	C	1	5.830089999999999	G	1	7.552421538461537	L	1	11.257173846153846
24		1	0	M	1	0.481386	LG	1	0.5297689999999999	E	1	0.99079	N	1	1.0627433333333334	P	1	1.23387	A	1	1.24497	K	1	1.51827	D	1	1.713215	T	1	1.78612	G	1	3.1405375	L	1	9.295783846153846	R	1	10.03951486080586
25		1	0	Q	1	0	Y	1	0.1097	N	1	0.11401	W	1	0.27325750000000004	R	1	0.30452199999999996	A	1	0.663064	L	1	0.76264	K	1	0.92774	G	1	0.95807	M	1	1.0995845934065935	H	1	1.3129425000000001	E	1	1.45089	D	1	1.62092	T	1	1.6569099999999999	V	1	2.1601666666666666	S	1	15.999817346153849
26		1	0	A	1	0.085518	V	1	0.19676	R	1	0.33285000000000003	P	1	0.46125	L	1	0.54761	Y	1	1.160635	M	1	1.1754499999999999	W	1	1.32335	G	1	1.7004000000000001	E	1	1.8172324999999998	Q	1	1.8589600000000002	T	1	2.6627208205128206	N	1	2.81246	S	1	4.843855333333334	GGT	2	0.9723416666666667	NT	2	5.036285
27	F	1	0		1	0	M	1	0.21592250000000002	S	1	0.39765	A	1	0.684404	H	1	0.75777	W	1	0.89632	T	1	0.94623	Y	1	0.96345	V	1	0.9959	G	1	1.2572	GA	1	1.5638299999999998	L	1	1.93456	E	1	2.404786666666667	P	1	2.499225	Q	1	5.2677733333333325	NT	2	0.53647
28	Y	1	0		1	0	C	1	0.97374	D	1	1.41008	P	1	1.6555400000000002	A	1	1.79495	K	1	2.30838	N	1	3.4753508333333336	T	1	9.3727775	S	1	15.460904000000001	VT	2	0.14140333333333333
29		1	0	V	1	0.80878	H	1	0.86346	W	1	0.96347	C	1	0.99685	T	1	0.99943	M	1	1.19406	G	1	4.77738	L	1	23.55682999999999
30		1	0	W	1	0.26232666666666665	Q	1	0.62184	N	1	0.90811	R	1	0.98356	V	1	0.99698	P	1	0.99997	M	1	1.3030633333333332	G	1	1.93539	S	1	1.98747	K	1	2.00787	L	1	18.5397375
31		1	0	C	1	0	Q	1	0.29777000000000003	Y	1	0.3332866666666667	L	1	0.3333333333333333	R	1	0.44858	H	1	0.97597	T	1	0.99736	N	1	1.50301	S	1	1.72783	K	1	2.25793	E	1	2.5658633333333336	D	1	8.54113
32	A	1	0	W	1	0		1	0	M	1	0	Q	1	0.08075	R	1	0.32234	P	1	0.33046666666666663	Y	1	0.66223	T	1	0.99891	N	1	1.54373	E	1	2.5794166666666665	L	1	3.9998299999999998	S	1	9.751486666666665
33	R	1	0.3333333333333333	L	1	0.7632533333333333	P	1	0.99908	F	1	1.3184200000000001	G	1	1.3297166666666667	V	1	1.6204	N	1	2.03292	E	1	2.57709	D	1	8.721712
34	K	1	0		1	0	R	1	0.33246333333333333	P	1	0.599506	N	1	0.88275	Q	1	0.9903	L	1	1.96109	T	1	2.92671	S	1	2.9798999999999998	W	1	2.99825	D	1	4.065136666666667
35		1	0	C	1	0.1836	Q	1	0.54284	L	1	0.5782	V	1	0.5827180000000001	S	1	0.88397	E	1	0.97909	F	1	0.99582	K	1	0.99971	R	1	1.11422	G	1	4.1468300000000005
36	V	1	0.07094333333333333	Q	1	0.26919	Y	1	0.28358333333333335	T	1	0.59452	S	1	0.77268	R	1	0.90507	L	1	0.99812	F	1	0.99873	K	1	0.99875	D	1	1.8756599999999999	N	1	3.47397
37	V	1	0.31259	L	1	0.3333	K	1	0.81459	A	1	0.99321	Y	1	0.99893	P	1	0.99988	T	1	3.4833
38	M	1	0.17722	W	1	0.99985	L	1	1.1258599999999999	R	1	1.41573	Y	1	2.2495833333333333
39	R	1	0.11318	Y	1	0.32971	V	1	0.77047	L	1	2.7736799999999997
40	A	1	0.7498687500000001	N	1	0.9639	D	1	1.45458
41		1	0	N	1	0.01549	AM	1	0.629245	W	1	0.75
42		1	0	R	1	0.98107	Y	1	5.082907083333334
43		1	0	Q	1	8.05015568181818
44		1	0	L	1	0.13534	K	1	8.987333836580088
45		1	0	Y	1	1.2246966666666668	Q	1	4.061437142857143	KPQ	3	0.8058
46	GL	1	0.909295	Q	1	1.1550833333333332	L	1	1.96103	A	1	1.97884	K	1	27.96355755627706
47	F	1	0.91823	A	1	0.9205	M	1	0.99323	N	1	0.99989	S	1	2.246576666666667	P	1	39.90540999317349	GP	2	1.5621099999999999
48		1	0	Y	1	0.32953	E	1	0.99936	P	1	0.99954	S	1	3.2132897435897436	G	1	43.137989563131306	QG	2	6.76014277056277	AN	2	7.6095025000000005	SGQ	3	0.9485325
49	AG	1	0	E	1	0.14319	C	1	0.19782	N	1	0.33707	G	1	0.96709	S	1	1.36399	V	1	1.8248600000000001	L	1	2.6037600000000003	A	1	3.191448076923077	Q	1	34.398778015151514	SQ	2	0.13629000000000002
50		1	0	Y	1	0	K	1	0.31656	G	1	0.51463	R	1	0.8079	L	1	0.87615	W	1	0.99131	Q	1	1.8431600000000001	T	1	6.499704444444444	S	1	58.96700766067268
51		1	0	L	1	0	E	1	0.39059	Q	1	0.39428250000000004	H	1	0.68884	N	1	0.99157	V	1	1	Y	1	1.59229	G	1	2.07544	D	1	2.0821346153846156	S	1	2.50366	P	1	64.93566002886001	LPQ	3	0.7127033333333334
52		1	0	R	1	0	N	1	0.66025	T	1	0.95248	P	1	1.31816	A	1	1.44981	C	1	1.70804	GA	1	1.8400150000000002	G	1	1.94144	L	1	2.1992866666666666	E	1	3.0356449999999997	D	1	6.360354615384616	Q	1	45.29876196103898	AAV	2	0.49991416666666666	LQ	2	1.726075
53		1	0	D	1	0.04882333333333333	F	1	0.07759166666666667	T	1	0.99874	P	1	0.99993	G	1	0.99998	V	1	1	A	1	1.34788	Y	1	1.5329607692307692	Q	1	1.5947399999999998	K	1	2.40815	R	1	4.295145	L	1	59.515971080086565
54	R	1	0.18206	V	1	0.2195	T	1	0.498375	Q	1	0.5311487500000001	Y	1	0.62183	A	1	0.8821	E	1	0.9938	S	1	1	C	1	1.4984375	N	1	2.6037999999999997	L	1	70.58086816083915
55		1	0	K	1	0.02544	A	1	0.49794249999999995	G	1	0.55478	T	1	0.97317	C	1	0.99997	P	1	1	R	1	1.07296	Y	1	1.4459175	Q	1	1.7467855555555556	L	1	67.4590018537296
56		1	0	A	1	0.46291	N	1	0.90578	D	1	0.95958	C	1	0.99977	E	1	0.99983	T	1	1.5621779999999998	V	1	1.7225100000000002	L	1	1.93303	S	1	1.9811	G	1	1.99845	P	1	5.715314358974359	Q	1	9.16106568181818	Y	1	44.420556740259734
57		1	0	H	1	0.32308	K	1	0.84252	AG	1	0.892695	A	1	0.89695	M	1	0.9555	W	1	0.99993	V	1	1.37169	R	1	1.7146400000000002	P	1	2.99948	N	1	3.225295	G	1	3.90163	S	1	4.715382948717949	Q	1	41.886648168831165
58	T	1	0		1	0	Y	1	0.11351	F	1	0.35823099999999997	W	1	0.59497	E	1	0.69138	R	1	0.71851	Q	1	0.9691	H	1	0.98891	K	1	0.99977	G	1	0.99998	P	1	1.64458	S	1	1.74101	V	1	4.044054	A	1	48.57103610481675	SA	2	0.67151	GT	2	1.70821
59		1	0	Q	1	0.67705	D	1	1.1698050000000002	G	1	1.6977600000000002	V	1	1.69791	E	1	1.95962	T	1	1.9609100000000002	L	1	1.96608	P	1	3.24683	S	1	41.85785241391942	TS	2	3.3086800000000003	TRS	3	0.5935166666666667
60	A	1	0		1	0	V	1	0.18228	Q	1	0.2327825	K	1	0.5088	M	1	0.5397	R	1	0.70097	F	1	0.99247	C	1	0.99818	P	1	1.81396	N	1	1.99915	S	1	4.042532	L	1	5.948236454545455	D	1	6.43349887254902	T	1	21.182110887445887	RT	2	0.72689
61		1	0	T	1	0.4990725	Q	1	0.5894	GL	1	0.60616	L	1	1	E	1	1.00175	N	1	1.58442	D	1	2.5991633333333333	A	1	2.8859725000000003	G	1	3.304655	P	1	4.951470151515151	S	1	5.5126825	R	1	22.633160636363638	AR	2	0.14834333333333335
62		1	0	T	1	0.499995	H	1	0.67812	Y	1	0.9448342857142856	R	1	0.971005	S	1	0.99944	N	1	1.05015	K	1	1.52051	F	1	3.2152478205128205	L	1	3.812078696969697	A	1	14.852040588235294	TG	2	0	SQ	3	0.25094500000000003	TN	3	0.269945
63		1	0	N	1	0.04733	Q	1	0.33066	P	1	0.4999975	G	1	0.8178018181818182	L	1	0.99986	V	1	1.8441964705882352	A	1	2.672715	T	1	10.885186693121693	S	1	16.785706666666666	GS	2	0.227645
64		1	0	T	1	0.3328233333333333	L	1	0.5377470588235295	N	1	0.788903	R	1	0.86455	V	1	0.92527	K	1	0.94854	S	1	0.99976	Q	1	1.4379454545454546	F	1	1.4999475	A	1	1.66259	G	1	27.374851724867725
65		1	0	Q	1	0.85084	L	1	0.99209	R	1	0.99792	K	1	1	N	1	1.0065433333333333	G	1	1.02704	T	1	1.8844383636363635	S	1	4.49638	V	1	22.059042042794896
66		1	0	C	1	0.06571	E	1	0.12421	K	1	0.40007	A	1	0.4814975	F	1	1.3992	L	1	1.51214	S	1	2.84473	P	1	28.33645535472371
67		1	0	Y	1	0.16456749999999998	M	1	0.43904	K	1	0.4848825	E	1	0.6745	T	1	0.99662	S	1	0.99993	V	1	1.4912275	A	1	1.99851	L	1	2.5078199999999997	D	1	20.998051979316976	RD	2	0.978925
68		1	0	D	1	0.95598	K	1	0.99818	T	1	1	G	1	2.583968	R	1	16.41919637926888	FR	2	1.567835
69		1	0	G	1	0	A	1	0.56682	T	1	0.6174	V	1	0.6803	Q	1	0.70435	R	1	0.91078	L	1	0.94792	K	1	1.226642	S	1	1.5186700000000002	P	1	1.8065075	Y	1	1.8258800000000002	F	1	8.078384761904761
70		1	0	T	1	0	Q	1	0.11716	L	1	0.32145	Y	1	0.5840799999999999	V	1	1.4242	A	1	1.52685	E	1	1.813058	S	1	8.48815	GS	2	1.670415
71		1	0	F	1	0.34806	A	1	0.92339	P	1	0.99988	L	1	1.182645	S	1	3.24538	G	1	9.683240117647058
72	Y	1	0.491	E	1	0.99145	V	1	0.99752	F	1	1.26101	T	1	1.41347	R	1	1.93184	S	1	12.154363676470586
73		1	0	D	1	0.031503333333333335	R	1	0.9914	V	1	0.9939	L	1	0.99674	S	1	1.1238825000000001	G	1	12.710533647058822
74	H	1	0.18713	F	1	0.29057	P	1	0.8383611764705883	Q	1	0.92267	G	1	0.99982	V	1	2.455175	Y	1	11.223332000000001
75	V	1	0	F	1	0.96806	P	1	0.99878	A	1	1.172065	G	1	9.186654117647059	SA	2	0.7750349999999999	AS	2	0.8403
76	V	1	0.21625	P	1	0.71865	D	1	0.94962	S	1	1.0303264705882353	T	1	6.048973333333333	DT	2	0.985695
77		1	0	A	1	0	M	1	0.60746	W	1	0.8712329411764705	F	1	0.99951	D	1	7.34088
78		1	0	G	1	0	K	1	0.58662	A	1	0.77668	P	1	0.85412	R	1	0.95929	Q	1	0.99102	L	1	0.9954	F	1	3.8431566666666668
79		1	0	Q	1	0	D	1	1.9233	T	1	5.96012
80		1	0	P	1	0	T	1	0.98906	F	1	5.9587699999999995
81		1	0	V	1	0	K	1	0.13315	E	1	0.29768	AV	1	0.99733	T	1	1.9997
82	Q	1	0.79544	Y	1	0.96907	G	1	1.99976	L	1	3.165093333333333
83	E	1	0.24831	V	1	1.9909599999999998	S	1	4.674216666666666
84	GL	1	0	N	1	0.38315	L	1	0.47488	S	1	0.48563	A	1	1.3321433333333332	R	1	1.9203000000000001	P	1	1.9998
85	M	1	0.39188	L	1	0.42556	R	1	0.74615	D	1	0.98255	V	1	7.742066666666666	DL	2	0.57785
86	E	1	0	R	1	0.14202	D	1	0.74222	N	1	0.76506	T	1	1.94899	Q	1	7.132476666666666
87	T	1	1.9975999999999998	A	1	9.298183333333334
88	F	1	0	Q	1	0.02849	T	1	0.99894	S	1	1.44668	E	1	6.519360000000001
89		1	0	V	1	0.99865	D	1	6.557923333333332
90		1	0	Q	1	0.12041	V	1	4.08695862745098	L	1	5.918869999999999
91	L	1	0.18914666666666669	T	1	0.8823517647058824	V	1	1	G	1	3.4015899999999997	A	1	7.4546866666666665
92	K	1	0.06772	G	1	0.61768	H	1	0.71658	A	1	0.8818094117647058	V	1	8.685443333333335
93		1	0	L	1	0.41894	F	1	0.92549	A	1	0.99942	N	1	0.99953	P	1	2.87832	Y	1	4.306016078431372
94		1	0	P	1	0.33332333333333336	N	1	0.8144705882352943	S	1	0.93432	A	1	0.9891	Y	1	1.06747	F	1	1.29522	G	1	1.57431	E	1	1.6214499999999998
95		1	0	Y	1	0.1841	Q	1	0.25485	W	1	0.32145666666666667	N	1	0.7011347058823528	A	1	0.72524	E	1	1.23853	C	1	6.228147976190476
96		1	0	E	1	0.09597	T	1	0.32675	D	1	1.01179	F	1	2.2028385714285714	M	1	2.291129411764706	H	1	6.130066666666666
97		1	0	Y	1	0.99861	F	1	0.99929	D	1	1.8566	E	1	2.2835099999999997	Q	1	11.578668179271709
98	R	1	0.28669	K	1	0.42545	G	1	0.63192375	L	1	0.79957	T	1	0.93755	Y	1	0.9862	VA	1	0.990625	V	1	0.99161	H	1	1.33102	N	1	1.4145325	S	1	2.0113129411764707	D	1	7.021038571428571
99	N	1	0.16971	D	1	0.92444	G	1	0.95307	A	1	0.99739	S	1	3.10091125	L	1	4.19137294117647	Y	1	9.24909488095238
100		1	0	D	1	0.16567	P	1	0.99614	N	1	1.0366475	Y	1	1.9881	E	1	2.8721699999999997	S	1	7.855316666666668
101		1	0	Q	1	0.81244	R	1	0.96361	L	1	1.93255	F	1	4.9683512499999996	S	1	10.234891547619046
102	T	1	0.9389	F	1	1.06563	Q	1	1.95607	A	1	1.9786000000000001	P	1	21.692912142857143
103	A	1	0.90065	G	1	1	L	1	26.8948555952381
104	Q	1	0		1	0	S	1	0.45489	D	1	1.8936833333333334	L	1	2.99381	T	1	26.178240595238098
105	E	1	0		1	0	S	1	0.49912	P	1	0.666665	G	1	0.85308	V	1	0.98184	A	1	2.99567	F	1	27.52071156746032
106		1	0	M	1	0.42006	V	1	0.6665550000000001	D	1	0.78676	S	1	0.98321	G	1	28.343835892857143	Q	2	2.434701111111111	NA	3	0.731
107	E	1	0.29441	K	1	0.69789	W	1	0.97276	G	1	0.99971	D	1	1	R	1	1.9859	T	1	2.748435	A	1	20.309093392857143	Q	2	1.37871	TQ	3	0.5262
108	T	1	0.01524	D	1	0.31408	P	1	0.99852	L	1	1	S	1	1	Q	1	1.31284	G	1	32.188503035714284	AS	2	0	SA	2	0.9563349999999999	KGT	3	0.8159666666666666
109		1	0	Y	1	0.5665266666666667	A	1	0.9932	H	1	1.48279	N	1	1.71388	V	1	1.74741	S	1	2.9736599999999997	Q	1	3.75293	T	1	24.711750238095238
110	R	1	0.30389125	E	1	0.90007	T	1	0.99609	S	1	0.9976	A	1	0.99931	L	1	0.99979	G	1	1	K	1	34.99346567460317	LK	2	0.410465
111	D	1	0.90376	V	1	0.99998	S	1	2.0218	L	1	26.62568156746032	EL	2	0.56005
112		1	0	N	1	0.28099	L	1	0.81987	T	1	0.99622	A	1	0.997	K	1	0.99742	G	1	0.99921	P	1	0.99997	E	1	16.794170873015872
113		1	0	N	1	0.4999175	G	1	0.53158875	K	1	0.82904	P	1	0.98095	V	1	0.99551	Q	1	1.7541600000000002	L	1	24.06768130952381
114		1	0	N	1	0.01851	Q	1	0.33218	F	1	0.72312	M	1	0.7462574999999999	V	1	0.99996	L	1	5.501920000000001	K	1	14.398760357142855
115		1	0	L	1	0.4999675	T	1	0.76893	K	1	0.98669	S	1	1	A	1	1	G	1	8.850046666666668	NA	2	0.99858
116		1	0	P	1	0.33329000000000003	L	1	0.98945	A	1	1	D	1	1	S	1	1	E	1	1.00448	T	1	1.42035	Q	1	1.9862824999999997	N	1	1.9894500000000002
117	S	1	0		1	0	R	1	0.23745333333333332	M	1	0.24835	K	1	0.6825859999999999	N	1	0.8715900000000001	D	1	1	Q	1	1	L	1	1.09282	A	1	1.38584	V	1	1.94028	P	1	4.649290000000001
118		1	0	H	1	1	N	1	1.0811933333333332	T	1	1.3349199999999999	A	1	1.98549	S	1	2.44465	L	1	2.577884	K	1	14.971455	LGS	2	0.57208	VSA	2	0.7107566666666667	GSL	2	1.3078825925925925	GTV	2	2.1677919444444447	EK	2	4.954901428571429	ASV	2	7.12571130952381
119		1	0	K	1	0.20687	G	1	0.45882	N	1	0.75518	S	1	0.92709	T	1	0.9689753333333335	P	1	1	A	1	1.19337	L	1	2.5504	V	1	3.102593333333333	E	1	3.3189558333333333	AE	2	1.42893
120	L	1	0		1	0	Q	1	0.3225733333333333	N	1	1	A	1	51.564461559523814
121		1	0	C	1	0.9225099999999999	L	1	1.3330633333333333	A	1	55.13875810714286	PSA	3	1.2116494444444443
122		1	0	D	1	0.78636	M	1	0.83724	K	1	0.90196	V	1	0.99703	Q	1	1	E	1	1.28368	L	1	1.7070773333333333	P	1	59.02008931349204
123		1	0	M	1	0.10682933333333335	D	1	0.58058	H	1	0.74693	N	1	0.80452	Q	1	0.85396	A	1	0.94382	P	1	1	E	1	1.829991666666667	S	1	60.79798767857141
124		1	0	R	1	0.1238	F	1	0.90805	S	1	1.11027	P	1	1.90448	V	1	64.5332772738095
125		1	0	R	1	0.57225	Y	1	0.82831	A	1	0.97935	E	1	1.001917777777778	M	1	1.160465	V	1	1.3006733333333333	T	1	1.98035	F	1	56.7351861547619
126		1	0	R	1	0.3389	G	1	0.92102	P	1	6.65376	L	1	44.304614126984134
127		1	0	G	1	0	S	1	0.05037	T	1	0.54406	V	1	0.94899	N	1	1	D	1	1.2361255555555557	P	1	1.6666666666666665	Y	1	1.99856	Q	1	2.8933299999999997	F	1	41.00932821428571	PF	2	0.33282500000000004
128		1	0	C	1	0	R	1	0.14568	K	1	0.33259	A	1	0.77241	Y	1	0.99378	L	1	1.8874300000000002	G	1	1.9794999999999998	Q	1	2.35764	V	1	2.4251275000000003	S	1	3.5906866666666666	P	1	63.12826649211569
129		1	0	M	1	0.264262	Q	1	0.27148	T	1	0.5185	W	1	0.70342	E	1	1	Y	1	1.4144114285714284	S	1	1.98523	C	1	2.34899	G	1	3.652182	V	1	4.550775625	L	1	6.099970540935672	A	1	7.560946666666667	P	1	54.70085258116447	SP	2	1.4833669642857144
130		1	0	R	1	0.16717	F	1	0.20287	K	1	0.93866	Q	1	1.0879792857142858	E	1	1.14711	N	1	1.2512985714285716	Y	1	1.2517176608187135	H	1	1.4368	T	1	1.7723	G	1	2.37275	D	1	2.38936	P	1	2.66118	V	1	2.70199	M	1	2.7498122368421054	C	1	2.8350066666666667	A	1	3.341151	L	1	7.53768	S	1	51.200489996337005	DS	2	0.3470455
131		1	0	T	1	0.38983	N	1	0.8798400000000001	H	1	0.93289	Y	1	1.0315400000000001	W	1	1.08931	K	1	1.2032500000000002	A	1	1.20677	P	1	1.22381	F	1	1.376067	G	1	1.68625	M	1	1.7644533333333334	E	1	1.7900800000000001	L	1	2.787842	C	1	3.51813	Q	1	4.55663	S	1	4.65016	V	1	18.708450287855054	D	1	41.249217569597064
132		1	0	T	1	0.21601	N	1	0.62105	Y	1	0.7438341666666667	M	1	0.81161	L	1	0.96544	W	1	0.97187	A	1	0.98856	G	1	1.5203000000000002	S	1	1.6020966666666667	C	1	1.9592875	H	1	1.97509	V	1	2.57945	D	1	3.25428	K	1	4.780948	Q	1	6.266115833333334	E	1	30.667625879120873	P	1	58.10295909341463
133		1	0	K	1	0.04778	Y	1	0.16688999999999998	W	1	0.65051	M	1	0.84171	L	1	0.99986	S	1	1	C	1	1.5583750000000003	H	1	1.9553408333333333	G	1	2.07818	T	1	2.7944	D	1	3.819386	P	1	5.547463333333333	V	1	5.714166923076923	Q	1	13.863606428571426	E	1	27.06614498687423	A	1	47.37740694094612	LE	2	0.362355	LQE	3	0.6600633333333333
134		1	0	Y	1	0.10650625	W	1	0.14017799999999997	N	1	0.2083	A	1	0.30577	T	1	0.532624	G	1	0.65832	R	1	0.9992869230769231	S	1	1.0183911111111112	D	1	1.21113875	H	1	1.55991	P	1	1.750603076923077	C	1	3.57677	V	1	10.412435976190476	L	1	241.53932110616188	QL	2	0.48550499999999996	AGL	2	0.6564272463768116	GAL	2	0.6774433333333333	AAV	2	0.7235866666666667
135		1	0	AA	1	0	D	1	0.31814	E	1	0.6747766666666667	W	1	0.81469	R	1	1.0087033333333333	AG	1	1.1857811944444445	GA	1	1.191015	N	1	1.5310590384615386	T	1	1.81228	A	1	1.9792100000000001	H	1	2.4072025	Y	1	2.5103885714285714	L	1	2.9376907692307697	S	1	2.9697	C	1	3.2731325	M	1	3.989319378205128	V	1	8.122025871794872	K	1	16.634717857142856	P	1	42.43669912148962	Q	1	159.63392876697503	AQ	2	0.993475
136		1	0	T	1	0.8993616666666667	S	1	0.90921	E	1	0.9848699999999999	H	1	1.06267	R	1	1.19095	W	1	2.1232633126934983	Y	1	2.2080777777777776	F	1	2.8637988888888892	G	1	2.93052	Q	1	3.3415199999999996	K	1	3.6046933333333335	C	1	4.287464318181819	M	1	11.014045626262625	L	1	11.21412238095238	V	1	11.474200053418805	A	1	73.49170001484478	P	1	100.88008680431041	QG	2	1.372523
137	E	1	0		1	0	F	1	0.11619	GG	1	0.53994	H	1	1.0422933333333333	R	1	1.11529	Q	1	1.296446	W	1	1.3144366666666665	C	1	1.7820127777777777	K	1	1.9426	G	1	1.96754	M	1	2.6125733333333336	D	1	3.9357810416666665	S	1	6.71073	T	1	8.044376190476191	N	1	14.950738274551536	V	1	20.94585559064328	P	1	41.46151509795923	L	1	50.37165973656898	A	1	119.04337544440166
138		1	0	E	1	0.24322999999999997	W	1	0.29331999999999997	Y	1	0.53904	M	1	0.79924	AV	1	0.89652	R	1	0.9828399999999999	F	1	0.99847	D	1	1.15319	GL	1	1.3475875	H	1	1.60239	G	1	2.7821727272727275	S	1	3.96929	V	1	4.33544	Q	1	6.6767528787878785	K	1	13.82156327777778	P	1	31.032848713037122	A	1	38.4806770396956	L	1	143.15471455037365
139		1	0	V	1	0	S	1	0.01279	M	1	0.55899	W	1	0.626886	D	1	0.7614666666666667	N	1	1.1416166666666667	E	1	1.50938	P	1	2.986765303030303	G	1	3.99819	Q	1	7.044720833333333	A	1	38.521962787057404	L	1	39.00579271051008	GA	2	1.7902056666666666	Q	2	248.75183602466603
140		1	0	D	1	0.13882250000000002	E	1	0.19857000000000002	A	1	0.26056	H	1	0.31861	N	1	0.603964	R	1	0.94044	M	1	1.0338566666666666	K	1	1.84698	S	1	2.99956	V	1	5.097271363636363	W	1	5.690617757575757	G	1	20.183295833333332	L	1	29.050884930142384	Q	1	35.201985512283464	PG	2	0.99989
141		1	0	L	1	0.12415	E	1	0.1752	D	1	0.59995	V	1	0.74534	M	1	0.90014	G	1	0.99956	Q	1	1.3124933333333333	R	1	1.3812161904761906	A	1	1.5643500000000001	S	1	2.44781	T	1	4.9213223308080805	N	1	5.143034166666666	W	1	6.801949987179488	P	1	438.0793510005466
142		1	0	D	1	0.23178	Q	1	0.31949	L	1	0.37104	R	1	0.44687	F	1	0.48443	P	1	0.99967	K	1	1.0868200000000001	S	1	1.570606	W	1	1.67965	Y	1	3.23964	A	1	7.966896527777778	T	1	11.174524525641027	V	1	432.75022372839896
143	S	1	0	Y	1	0.08702	C	1	0.47925	M	1	0.5208	F	1	0.99708	R	1	1	A	1	1	G	1	1.4468	T	1	1.99675	V	1	2.74657	Q	1	7.8764	L	1	452.5622454565205
144	L	1	0	H	1	0.08072199999999999	R	1	0.71794	N	1	0.77031	A	1	0.96983	E	1	0.99877	Y	1	1	C	1	1	D	1	1.44359	K	1	1.4476475	Q	1	2.36976	T	1	2.94344	P	1	4.598548	V	1	53.87212852863312	S	1	389.05928855658647	GV	2	0.74599
145		1	0	M	1	0.22041	N	1	0.5853240000000001	V	1	0.64588	Q	1	0.77278	T	1	0.83498	Y	1	0.94016	K	1	0.9875	D	1	0.9978	A	1	0.99991	R	1	1.62836	P	1	2.599704	E	1	2.7796333333333334	L	1	2.9369458333333336	S	1	8.9246	G	1	422.2859099625831	AV	2	0.946795	LG	2	0.9841249999999999	VA	2	1.1571694642857142
146	Q	1	0		1	0	Y	1	0.34533	E	1	0.401976	H	1	0.7960199999999998	R	1	0.84516	A	1	0.99989	F	1	1.03792	T	1	1.98069	G	1	2.9686	V	1	4.782578666666667	L	1	447.0581035143328
147		1	0	F	1	0.35157	R	1	0.84273	S	1	0.99086	E	1	0.99781	G	1	0.99874	K	1	1.69471	H	1	1.908088	M	1	2.2996600000000003	T	1	2.759521666666666	N	1	2.9952199999999998	V	1	28.756419434721295	L	1	32.744734083333334	VT	2	1.1731150000000001	SDL	3	0.46075
148	M	1	0		1	0	L	1	0.19845333333333334	D	1	0.62905	G	1	0.66949	H	1	0.69866	F	1	0.87106	R	1	0.9379041666666666	N	1	0.94524	Y	1	0.97378	E	1	0.9982	A	1	1.45927	T	1	2.452968	K	1	2.527424861111111	V	1	2.72759	Q	1	3.5527539999999997	S	1	48.25352749758264
149	N	1	0	S	1	0		1	0	K	1	0.31332	A	1	0.9524665432098764	T	1	0.99836	Y	1	0.99999	Q	1	1.4842185714285714	M	1	1.8205856140350876	P	1	1.93157	R	1	2.0595033333333332	L	1	2.1595299999999997	V	1	2.95502	E	1	4.139298	G	1	4.804538	D	1	15.026318	W	1	17.691235381790623
150		1	0	A	1	0.13082631578947368	K	1	0.4922375	W	1	0.51671	C	1	0.63078	Q	1	0.99444	D	1	0.99504	S	1	1.2354833333333333	M	1	1.6494376172839507	R	1	1.7231800000000002	Y	1	2.65768	G	1	4.429982857142857	V	1	4.944529999999999	F	1	5.420536333333334	L	1	6.340051714285714	T	1	7.962394
151		1	0	H	1	0	F	1	0.88991	W	1	0.97605	M	1	0.99791	E	1	0.99858	K	1	1.2243475	T	1	1.6605071428571427	G	1	1.76609	L	1	1.98449	V	1	2.5361116666666668	D	1	3.1629933333333335	A	1	3.516654	Y	1	7.524663333333333	PY	2	6.9997300000000005
152		1	0	E	1	0.49316	N	1	0.5455857142857143	K	1	0.593022	M	1	0.63398	R	1	0.81011	D	1	0.84267	Q	1	0.95588	V	1	0.99368	S	1	0.99967	L	1	1.33592	P	1	18.65315466666667
153		1	0	P	1	0	N	1	0.6513333333333333	R	1	0.90836	W	1	0.99955	V	1	0.99973	A	1	4.555171428571429	G	1	18.178700999999997	Q	2	12.262931250000003	LN	3	0
154		1	0	G	1	0	M	1	0.63166	P	1	0.91902	Q	1	0.99611	S	1	1.6663666666666668	V	1	1.7014200000000002	R	1	1.79467	H	1	2.6866713333333334	A	1	14.036744285714285	LG	2	0.99949
155		1	0	K	1	0	W	1	0.89753	Q	1	1.2287	G	1	1.23713	M	1	1.2961023333333332	P	1	3.99897	V	1	23.40938375	TV	2	0.616415	LS	2	0.9214150000000001
156		1	0	Q	1	0.37544	S	1	0.6592833333333333	G	1	0.73493	D	1	0.98792	P	1	0.99971	A	1	3	V	1	3.9839599999999997	T	1	10.961906666666666	LS	2	0.999645	SL	2	9.694726041666668
157		1	0	S	1	0.27141	F	1	0.6120483333333333	E	1	0.9934	A	1	3.9991	V	1	13.073906666666668	GL	2	0	LG	2	0.9970749999999999
158		1	0	R	1	0.95671	L	1	1.62052	V	1	1.97465	S	1	2.6307066666666667	Q	1	3.2456425	N	1	6.44623	A	1	13.89746
159		1	0	M	1	0.01524	DS	1	0.688829375	V	1	0.87505	A	1	0.99952	N	1	0.99957	L	1	0.99972	S	1	1.59603	D	1	2.6238266666666665	P	1	3	G	1	4.99957	W	1	7.049288333333333	KW	2	0.53012
160		1	0	AV	1	0	N	1	0.99921	VA	1	0.999565	T	1	1.89667	P	1	3.99973	E	1	4.35302	K	1	9.324436666666667
161		1	0	L	1	0.0618	S	1	0.33093333333333336	M	1	0.89153	T	1	2.60425	F	1	2.79018	A	1	11.672835000000001
162		1	0	V	1	0	F	1	0.7495324999999999	G	1	0.76139	C	1	0.91793	E	1	1	P	1	1	S	1	1.4034833333333332	T	1	1.98819	L	1	2.1901800000000002	A	1	2.31905	D	1	6.120760000000001
163		1	0	S	1	0.13565	M	1	0.27155	A	1	1.16544	Q	1	1.9717099999999999	T	1	1.97717	F	1	1.98339	E	1	2	K	1	2.99703	G	1	8.133048333333333
164	L	1	0.11056	F	1	0.3329566666666667	R	1	0.98387	V	1	0.99998	A	1	1	T	1	1.69095	K	1	2	P	1	2.6666266666666667	G	1	2.98858	S	1	18.00660357142857
165	Q	1	0.36429	Y	1	0.99775	G	1	0.99999	N	1	2.37163	S	1	3.99834	D	1	10.071073928571428	P	1	10.613686666666666
166		1	0	D	1	0.31682	C	1	0.68445	K	1	1	E	1	1.04183	S	1	3.8117900000000002	V	1	18.156382142857144
167	E	1	0		1	0	Y	1	0.08358	S	1	0.6215116666666667	M	1	0.95033	L	1	0.98368	H	1	0.99102	T	1	0.99735	K	1	9.0995	V	1	12.177695714285713
168		1	0	E	1	0.41884333333333335	D	1	0.65563	S	1	0.97071	P	1	0.99999	K	1	1	V	1	15.389076904761906
169		1	0	T	1	0.05286	L	1	0.6649433333333333	D	1	0.9885	G	1	7.00297	A	1	10.430625000000001
170	S	1	0	M	1	0.96739	L	1	1.6522216666666667	V	1	6.41598	G	1	10.917706785714287	DL	2	0.85082
171		1	0	Q	1	0.95973	C	1	0.9953	Y	1	3.93435	E	1	10.608096666666667
172		1	0	Q	1	0.98057	L	1	0.99955	T	1	1.12036	F	1	10.60010357142857
173	A	1	0.9948	T	1	2.64116	D	1	10.994216666666668
174	L	1	0.99898	K	1	2.018355	Q	1	10.37947761904762
175	T	1	0.98234	P	1	0.99042	S	1	0.9981	G	1	9.173298333333333
176	R	1	0.94301	T	1	0.96365	S	1	9.282014523809524
177		1	0	M	1	0.42159	K	1	7.033088928571429
178		1	0	E	1	0.88021	D	1	1.0233866666666667	Q	1	1.26827	T	1	2.10593	S	1	3.109995714285714
179	T	1	1.9152042857142857	K	1	1.97461	S	1	5.182830000000001
180	E	1	0.22669	T	1	1.4397908333333334	D	1	1.6547985714285716	L	1	1.8631700000000002	N	1	2.52477
181	N	1	0.04275	D	1	0.24472000000000002	P	1	0.39058	Q	1	2.7416600000000004
182	R	1	0.75866	G	1	0.99903	K	1	3.274506666666667
183	E	1	0	P	1	0.98898	Y	1	1.4345906666666666	L	1	2.789886666666667	AY	2	0
184	V	1	0.10087	L	1	0.67765	A	1	0.7448720000000001	G	1	1.2973633333333332
185	Q	1	0.98341	A	1	3.019417333333333
186	E	1	0	S	1	7.653178
187	E	1	0.03253	K	1	0.20969	N	1	0.74023	L	1	1.713	S	1	3.2926048333333333
188	D	1	0.98771	S	1	1	P	1	1.14951	Q	1	1.66953	Y	1	4.685876666666667
189	Q	1	0	S	1	0.09542	W	1	0.4733575	H	1	0.96337	N	1	2.7485600000000003	L	1	9.747948
190		1	0	T	1	0.99955	E	1	1.46928	S	1	16.121407
191	K	1	0	N	1	0.94008	M	1	0.99162	G	1	0.99848	L	1	16.20770733333333
192		1	0	N	1	0.69653	G	1	0.99887	P	1	0.99992	L	1	1.49515	D	1	1.642656	T	1	10.624592
193	S	1	0		1	0	T	1	0	E	1	0.83765	H	1	0.99562	A	1	0.99991	N	1	1.4043700000000001	D	1	3.1162433333333333	L	1	4.95937	P	1	5.197456
194		1	0	K	1	0.28467	S	1	0.3331	A	1	0.99808	L	1	0.99954	N	1	1.96018	E	1	8.264668	QE	2	0
195		1	0	C	1	0.17959	Y	1	0.54122	D	1	0.57702	E	1	0.9091666666666667	G	1	0.97378	L	1	1.3422100000000001	N	1	3.3234275	Q	1	6.55656
196		1	0	M	1	0.22888	MA	1	0.597125	K	1	0.64337	Q	1	0.86374	V	1	0.95582	Y	1	0.97568	G	1	0.99595	D	1	1.96838	S	1	1.99803	W	1	3.404119833333333	KW	2	0.536095
197		1	0	P	1	0.99997	K	1	9.124567999999998
198		1	0	E	1	0.06998	L	1	0.73316	G	1	0.99745	T	1	1	Y	1	1.9977200000000002	S	1	2.7107
199		1	0	A	1	0.16646	H	1	0.46082	Q	1	0.9222	V	1	0.99175	G	1	1	S	1	1
200		1	0	V	1	0.95645	GL	1	0.97219	G	1	0.99996	F	1	1
201		1	0	S	1	6.96364
202		1	0	S	1	0.6271	L	1	0.65921	P	1	0.99921	Y	1	3.2785
203		1	0	V	1	0.14061	T	1	0.44708	K	1	0.62078	N	1	0.8895	S	1	3.05477
204		1	0	L	1	0.40029	M	1	0.52099	V	1	0.82626	G	1	0.92202	C	1	4.84238
205		1	0	M	1	0.48268	V	1	0.96095	E	1	0.98951	T	1	0.99992	Q	1	1.87546	R	1	2.1714200000000003
206	Q	1	0.72539	V	1	8.72799090909091
207		1	0	L	1	0.95756	T	1	8.315814545454545
208		1	0	W	1	0.8102572727272727	L	1	0.9152899999999999	S	1	0.99946	H	1	4.93147
209	P	1	0	K	1	0.8048927272727272	S	1	0.98974	Q	1	0.99818	L	1	0.99896	F	1	1.7569599999999999	E	1	2.57206
210	V	1	0		1	0	H	1	0.42815000000000003	E	1	0.51649	G	1	3.1980236363636365
211	Y	1	0	K	1	0.32992	L	1	0.75295	F	1	0.99763	P	1	0.99997	S	1	4.497774545454545
212	D	1	0	M	1	0.14937	E	1	0.40265	K	1	0.79267	F	1	0.8160909090909091	V	1	0.99987	T	1	1.9301
213	M	1	0		1	0	A	1	0.84548	E	1	0.90299	S	1	0.99867	V	1	1.80361
214	L	1	0	Q	1	0.99432	E	1	4.92658	SGL	2	0.4511533333333333
215	Q	1	0.98785	K	1	4.98158
216	D	1	0.19982	T	1	0.99792	S	1	0.99871	VT	2	0.9913749999999999
217	V	1	0.83734	L	1	0.85275	S	1	0.98536	T	1	0.99069
218	K	1	0.99872	A	1	3.65348
219	P	1	0.99672	A	1	0.99696
220	A	1	0.98873	N	1	0.99958
221	A	1	0.23175
222	K	1	0.99779
223	T	1	0.83306

Variant Graph

Determine stroke width:

LocalGlobal

Higher Order Variant Graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

Depth of Coverage of the Consensus Sequence

Label	Value
"0"	2.96
""	20
""	11.3
""	22.8
""	20
""	24.9
""	18.9
""	27.8
""	33.7
""	37.4
""	26
""	25
""	25.3
""	21.4
""	21.3
""	17.6
""	19.9
""	26.9
""	27.7
""	34.3
"20"	40.9
""	40.6
""	38
""	34.4
""	33
""	29.4
""	27
""	27
""	36.6
""	34.2
""	30.5
""	20
""	20.3
""	19.7
""	17.7
""	11
""	11.2
""	7.94
""	5.97
""	3.99
"40"	3.17
""	1.39
""	6.06
""	8.05
""	9.12
""	6.09
""	34
""	47.5
""	64
""	45.2
""	70.8
""	77.4
""	69
""	74.8
""	79.6
""	75.8
""	72.8
""	64.7
""	64.8
""	60.1
"60"	46.3
""	47.3
""	29.1
""	35.1
""	37.4
""	34.3
""	35.2
""	31.7
""	23.5
""	18.9
""	15.9
""	16.4
""	19.2
""	16.8
""	16.9
""	13.9
""	9.95
""	9.82
""	9.01
""	7.88
"80"	6.95
""	3.43
""	6.93
""	6.91
""	6.6
""	10.9
""	10.7
""	11.3
""	8.99
""	7.56
""	10.1
""	12.9
""	11
""	10.5
""	8.63
""	9.65
""	12.1
""	17.7
""	17.8
""	19.6
"100"	14.9
""	18.9
""	27.6
""	28.8
""	31.5
""	33.5
""	34.4
""	30.9
""	38.6
""	37.9
""	41.6
""	31.1
""	22.9
""	29.7
""	22.7
""	14.1
""	10.7
""	13.1
""	42.2
""	15.9
"120"	52.9
""	58.6
""	66.5
""	67.7
""	68.6
""	64.6
""	52.2
""	51.7
""	77.6
""	86.6
""	87.4
""	90
""	118
""	117
""	267
""	256
""	236
""	279
""	253
""	347
"140"	347
""	465
""	462
""	471
""	462
""	451
""	461
""	79
""	67.9
""	57.3
""	40.1
""	34.2
""	26.9
""	38.6
""	25.4
""	33.6
""	32.4
""	19.9
""	30.8
""	24.4
"160"	21.6
""	18.4
""	18.5
""	20.6
""	30.8
""	29.4
""	25
""	25.9
""	19.4
""	19.1
""	20.8
""	16.5
""	13.7
""	14.6
""	13.4
""	12.1
""	11.2
""	7.45
""	8.39
""	9.07
"180"	7.71
""	3.42
""	5.03
""	5.21
""	2.82
""	4
""	7.65
""	5.99
""	9.49
""	14
""	18.6
""	19.1
""	16.5
""	17.5
""	12.8
""	14.4
""	13.2
""	10.1
""	7.51
""	4.54
"200"	3.93
""	6.96
""	5.56
""	5.15
""	7.51
""	7.48
""	9.45
""	9.27
""	7.66
""	8.12
""	4.14
""	7.58
""	5.09
""	4.55
""	6.37
""	5.97
""	3.19
""	3.67
""	4.65
""	1.99
"220"	1.99
""	0.232
""	0.998
""	0.833

Scores

Length	Score	Matches	Unique Score	Unique Matches
223	5.99E+04	1240	0	0

Order

IGKV2-40 → IGKJ4 → IGLC7

Alignment

10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210

DIVMTQTPL-SLPVT-PGE--PASISCR-SSQ-SLLD-SDDGNTYLDWYQKQKPGQ-S-PQL--L--IY--Q---AS---TRASGVPD-RFSGSGYGTDF-TFKISRVEAEDVGVYYCM-QRIEF-PLTFGAGT-KLE-IK-GQPKE---AAPSVFL--FPP--SDEE--LQ-ANK----AG-PV---L--V--G--LL-SDF---YPGAVTVAWKAD-G---SPVKVGV-ETTKPSKQSNNKYAASS-YLSLTPEQWKSHRS-YSCRVTHE--GSTVEKTVAPAECS

Combined

Type	Read
Score	54
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_010

Type	Read
Score	29
Start on Template	7
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C111_002

Type	Read
Score	44
Start on Template	8
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_091

Type	Read
Score	101
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C116

Type	Read
Score	100
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C233

Type	Read
Score	61
Start on Template	21
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C359

Type	Read
Score	44
Start on Template	48
Length on Template	16
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C823

Type	Read
Score	41
Start on Template	185
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_038

Type	Read
Score	101
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_044

Type	Read
Score	112
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_067

Type	Read
Score	42
Start on Template	62
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C598

Type	Read
Score	49
Start on Template	142
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_225

Type	Read
Score	126
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_3132

Type	Read
Score	102
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C723

Type	Read
Score	89
Start on Template	117
Length on Template	19
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_171

Type	Read
Score	126
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1045_002

Type	Read
Score	40
Start on Template	142
Length on Template	18
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C7_002

Type	Read
Score	34
Start on Template	156
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C73_003

Type	Read
Score	39
Start on Template	54
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_188

Type	Read
Score	39
Start on Template	163
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_112

Type	Read
Score	55
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C108_003

Type	Read
Score	52
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C124_002

Type	Read
Score	29
Start on Template	56
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1731

Type	Read
Score	36
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_134

Type	Read
Score	29
Start on Template	39
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1751

Type	Read
Score	126
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C465

Type	Read
Score	43
Start on Template	47
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_094

Type	Read
Score	42
Start on Template	137
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_151

Type	Read
Score	38
Start on Template	117
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_1532

Type	Read
Score	31
Start on Template	8
Length on Template	12
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_208

Type	Read
Score	34
Start on Template	142
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_155

Type	Read
Score	85
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_212

Type	Read
Score	98
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_107

Type	Read
Score	34
Start on Template	138
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C858

Type	Read
Score	42
Start on Template	63
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1673

Type	Read
Score	81
Start on Template	182
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_168

Type	Read
Score	42
Start on Template	148
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1085

Type	Read
Score	45
Start on Template	105
Length on Template	19
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_172

Type	Read
Score	61
Start on Template	121
Length on Template	14
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_1277

Type	Read
Score	116
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_1709

Type	Read
Score	42
Start on Template	139
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C24_002

Type	Read
Score	38
Start on Template	154
Length on Template	13
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_185

Type	Read
Score	35
Start on Template	142
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C116_004

Type	Read
Score	39
Start on Template	163
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C136_003

Type	Read
Score	52
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C182

Type	Read
Score	44
Start on Template	203
Length on Template	15
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C197_002

Type	Read
Score	36
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C236_002

Type	Read
Score	38
Start on Template	78
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C392_002

Type	Read
Score	41
Start on Template	38
Length on Template	19
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C440_002

Type	Read
Score	42
Start on Template	53
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C491_002

Type	Read
Score	116
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1463

Type	Read
Score	34
Start on Template	142
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C651

Type	Read
Score	116
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C900

Type	Read
Score	41
Start on Template	122
Length on Template	18
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1490

Type	Read
Score	116
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_1546

Type	Read
Score	116
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1459

Type	Read
Score	44
Start on Template	100
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_1413

Type	Read
Score	39
Start on Template	142
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C127

Type	Read
Score	75
Start on Template	61
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C468

Type	Read
Score	96
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1774

Type	Read
Score	93
Start on Template	182
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1156_002

Type	Read
Score	70
Start on Template	121
Length on Template	14
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1283

Type	Read
Score	39
Start on Template	139
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1474

Type	Read
Score	40
Start on Template	139
Length on Template	9
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_349

Type	Read
Score	32
Start on Template	47
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_2775

Type	Read
Score	36
Start on Template	57
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1811

Type	Read
Score	58
Start on Template	7
Length on Template	21
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_422

Type	Read
Score	42
Start on Template	46
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_257

Type	Read
Score	36
Start on Template	128
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_259

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_260

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_550

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_325

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_430

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1015

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_385

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_279

Type	Read
Score	42
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_244

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_277

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_275

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_276

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_440

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_245

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_334

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_442

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2493

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1750

Type	Read
Score	53
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_844

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_335

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_278

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_336

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1779

Type	Read
Score	38
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_397

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_445

Type	Read
Score	45
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_395

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_484

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_398

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_337

Type	Read
Score	41
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_562

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_338

Type	Read
Score	42
Start on Template	119
Length on Template	27
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_341

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_286

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_281

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_342

Type	Read
Score	49
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_282

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1833

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_283

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_343

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_345

Type	Read
Score	47
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1853

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_403

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3145

Type	Read
Score	47
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_346

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_404

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1882

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_284

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_285

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_287

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1904

Type	Read
Score	36
Start on Template	57
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C378_004

Type	Read
Score	42
Start on Template	64
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1070

Type	Read
Score	42
Start on Template	46
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2796

Type	Read
Score	31
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_818

Type	Read
Score	35
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1130_002

Type	Read
Score	42
Start on Template	185
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_321

Type	Read
Score	41
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_427

Type	Read
Score	43
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1554_002

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1916

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1639

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_271

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_496

Type	Read
Score	37
Start on Template	152
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_382

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1908

Type	Read
Score	34
Start on Template	8
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2966

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_845

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2018

Type	Read
Score	44
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2078

Type	Read
Score	51
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2079

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_330

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2114

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_728

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2171

Type	Read
Score	34
Start on Template	11
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_734

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_628

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2222

Type	Read
Score	43
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C2316

Type	Read
Score	60
Start on Template	119
Length on Template	27
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C2324

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_340

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2332

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_660

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2819

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3155

Type	Read
Score	54
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2820

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_350

Type	Read
Score	31
Start on Template	47
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C227

Type	Read
Score	35
Start on Template	28
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_360

Type	Read
Score	40
Start on Template	119
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_371

Type	Read
Score	42
Start on Template	46
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_468

Type	Read
Score	45
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_587

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_514

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2967

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_383

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_475

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_476

Type	Read
Score	35
Start on Template	186
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_387

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_620

Type	Read
Score	45
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_391

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3223

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1962

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_622

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1226

Type	Read
Score	37
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_520

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_394

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_483

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_561

Type	Read
Score	55
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_444

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2131

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_402

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2150

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_446

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_563

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_447

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_405

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_454

Type	Read
Score	51
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_420

Type	Read
Score	61
Start on Template	1
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_543

Type	Read
Score	42
Start on Template	25
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_546

Type	Read
Score	44
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_669

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_515

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_472

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_432

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_437

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1838_002

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_439

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_441

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1879

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1899

Type	Read
Score	43
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1926

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_443

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_882

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1982_002

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_525

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_485

Type	Read
Score	39
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_526

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2983

Type	Read
Score	38
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2984

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_601

Type	Read
Score	31
Start on Template	47
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_604

Type	Read
Score	30
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_548

Type	Read
Score	37
Start on Template	142
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_552

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_947

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_554

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_672

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_478

Type	Read
Score	42
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1225

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1895_002

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_482

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2048

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2069

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_488

Type	Read
Score	53
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_489

Type	Read
Score	57
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_490

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_566

Type	Read
Score	37
Start on Template	107
Length on Template	10
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_568

Type	Read
Score	34
Start on Template	152
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C377_004

Type	Read
Score	39
Start on Template	4
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_555

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1731

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_597

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_623

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_524

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1821_002

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1864

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1868_002

Type	Read
Score	57
Start on Template	125
Length on Template	21
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_522

Type	Read
Score	52
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_523

Type	Read
Score	55
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1931

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3170

Type	Read
Score	39
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1962_002

Type	Read
Score	47
Start on Template	125
Length on Template	21
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_565

Type	Read
Score	46
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_891

Type	Read
Score	30
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C126_004

Type	Read
Score	29
Start on Template	107
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1715

Type	Read
Score	35
Start on Template	24
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_655

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_594

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1827_002

Type	Read
Score	48
Start on Template	138
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1869_004

Type	Read
Score	63
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_952

Type	Read
Score	41
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_559

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3154

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1928_002

Type	Read
Score	65
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_624

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1968_002

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_883

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1032

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C75_007

Type	Read
Score	38
Start on Template	47
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C773_003

Type	Read
Score	42
Start on Template	151
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1407

Type	Read
Score	48
Start on Template	142
Length on Template	25
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

Combined_648

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_652

Type	Read
Score	37
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1616_003

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1861_004

Type	Read
Score	37
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1295

Type	Read
Score	41
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_657

Type	Read
Score	38
Start on Template	135
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_658

Type	Read
Score	53
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_2685

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_659

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_678

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_629

Type	Read
Score	38
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1230

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_630

Type	Read
Score	36
Start on Template	47
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C418

Type	Read
Score	47
Start on Template	163
Length on Template	20
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_666

Type	Read
Score	52
Start on Template	1
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_671

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1668

Type	Read
Score	41
Start on Template	4
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1728_003

Type	Read
Score	53
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3807

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3048

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2977

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1945

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1947

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1957_002

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1962_004

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1983_004

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2007_003

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1085

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2790

Type	Read
Score	58
Start on Template	7
Length on Template	21
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

Combined_638

Type	Read
Score	35
Start on Template	94
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1456

Type	Read
Score	31
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_731

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1841

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1808_003

Type	Read
Score	50
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1934_003

Type	Read
Score	50
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1955_003

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C28_004

Type	Read
Score	31
Start on Template	188
Length on Template	11
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1746

Type	Read
Score	44
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3221

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2623

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_677

Type	Read
Score	41
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_881

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2540

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_957

Type	Read
Score	46
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_879

Type	Read
Score	45
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1935_004

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C415_002

Type	Read
Score	40
Start on Template	117
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1759_002

Type	Read
Score	53
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1839_004

Type	Read
Score	34
Start on Template	24
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1847_002

Type	Read
Score	45
Start on Template	136
Length on Template	12
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1889_003

Type	Read
Score	46
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_954

Type	Read
Score	43
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1987

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3710

Type	Read
Score	35
Start on Template	16
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2070

Type	Read
Score	34
Start on Template	16
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2364

Type	Read
Score	35
Start on Template	16
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2083

Type	Read
Score	42
Start on Template	56
Length on Template	19
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C588_003

Type	Read
Score	36
Start on Template	2
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3456

Type	Read
Score	31
Start on Template	52
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2587

Type	Read
Score	34
Start on Template	53
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_766

Type	Read
Score	34
Start on Template	189
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C752_004

Type	Read
Score	49
Start on Template	163
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_715

Type	Read
Score	40
Start on Template	152
Length on Template	12
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_869

Type	Read
Score	48
Start on Template	163
Length on Template	17
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_975

Type	Read
Score	47
Start on Template	163
Length on Template	17
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C1048_002

Type	Read
Score	54
Start on Template	136
Length on Template	33
Start on Read	0
Length of Read	26
Positional Score
Alignment graphic

Combined_3505

Type	Read
Score	32
Start on Template	27
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C1399_003

Type	Read
Score	50
Start on Template	152
Length on Template	28
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

Combined_799

Type	Read
Score	31
Start on Template	2
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1830

Type	Read
Score	38
Start on Template	49
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_812

Type	Read
Score	44
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_815

Type	Read
Score	48
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C2006_002

Type	Read
Score	30
Start on Template	0
Length on Template	13
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_823

Type	Read
Score	47
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_828

Type	Read
Score	42
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_830

Type	Read
Score	39
Start on Template	138
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3905

Type	Read
Score	43
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C2549

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_833

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2761

Type	Read
Score	36
Start on Template	19
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_834

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2613

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2619

Type	Read
Score	40
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2644

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_841

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_842

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2982

Type	Read
Score	41
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C3037

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3069

Type	Read
Score	38
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_848

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_880

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2017

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_849

Type	Read
Score	48
Start on Template	138
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_850

Type	Read
Score	46
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1923

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3161

Type	Read
Score	43
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_856

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_854

Type	Read
Score	49
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2019

Type	Read
Score	55
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C3205

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3209

Type	Read
Score	49
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C411_004

Type	Read
Score	31
Start on Template	4
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1241

Type	Read
Score	33
Start on Template	131
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_902

Type	Read
Score	49
Start on Template	163
Length on Template	17
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C813_002

Type	Read
Score	31
Start on Template	13
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3896

Type	Read
Score	31
Start on Template	27
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1033_002

Type	Read
Score	53
Start on Template	139
Length on Template	29
Start on Read	0
Length of Read	25
Positional Score
Alignment graphic

C1042_003

Type	Read
Score	50
Start on Template	163
Length on Template	17
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C1182_003

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C2522

Type	Read
Score	42
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2546

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2525

Type	Read
Score	46
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3453

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2741_002

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2747

Type	Read
Score	37
Start on Template	136
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2808

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1921

Type	Read
Score	40
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2978

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3081

Type	Read
Score	43
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2024

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3181

Type	Read
Score	34
Start on Template	108
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_892

Type	Read
Score	35
Start on Template	58
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_1934

Type	Read
Score	47
Start on Template	163
Length on Template	22
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C1157

Type	Read
Score	49
Start on Template	142
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1320_003

Type	Read
Score	44
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1018

Type	Read
Score	38
Start on Template	0
Length on Template	11
Start on Read	3
Length of Read	10
Positional Score
Alignment graphic

C1879_003

Type	Read
Score	52
Start on Template	138
Length on Template	33
Start on Read	0
Length of Read	27
Positional Score
Alignment graphic

Combined_1227

Type	Read
Score	44
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_955

Type	Read
Score	39
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1084

Type	Read
Score	47
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1297

Type	Read
Score	46
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C116_009

Type	Read
Score	31
Start on Template	211
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1107

Type	Read
Score	41
Start on Template	54
Length on Template	14
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1251

Type	Read
Score	49
Start on Template	54
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C866_002

Type	Read
Score	59
Start on Template	146
Length on Template	22
Start on Read	0
Length of Read	26
Positional Score
Alignment graphic

Combined_984

Type	Read
Score	70
Start on Template	45
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2791

Type	Read
Score	39
Start on Template	85
Length on Template	16
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1742_004

Type	Read
Score	58
Start on Template	140
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_1132

Type	Read
Score	39
Start on Template	138
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2037_002

Type	Read
Score	41
Start on Template	140
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1009

Type	Read
Score	39
Start on Template	19
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1014

Type	Read
Score	35
Start on Template	142
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2523

Type	Read
Score	43
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2468

Type	Read
Score	38
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2880_003

Type	Read
Score	39
Start on Template	135
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1023

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1025

Type	Read
Score	40
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1144

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C3103_002

Type	Read
Score	39
Start on Template	156
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1030

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1031

Type	Read
Score	54
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C8_003

Type	Read
Score	36
Start on Template	59
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C835_005

Type	Read
Score	52
Start on Template	163
Length on Template	22
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C1703_003

Type	Read
Score	58
Start on Template	140
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_1135

Type	Read
Score	34
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C2660

Type	Read
Score	49
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2491

Type	Read
Score	42
Start on Template	137
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2998_002

Type	Read
Score	38
Start on Template	133
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2689

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1147

Type	Read
Score	56
Start on Template	54
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1159

Type	Read
Score	64
Start on Template	42
Length on Template	12
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_1098

Type	Read
Score	60
Start on Template	45
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1101

Type	Read
Score	88
Start on Template	103
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C583_002

Type	Read
Score	51
Start on Template	10
Length on Template	14
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C679_004

Type	Read
Score	84
Start on Template	45
Length on Template	22
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3233

Type	Read
Score	42
Start on Template	116
Length on Template	9
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1258

Type	Read
Score	61
Start on Template	46
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1365

Type	Read
Score	99
Start on Template	120
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1500_003

Type	Read
Score	102
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_3864

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1980

Type	Read
Score	40
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1083

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2010_006

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1146

Type	Read
Score	36
Start on Template	146
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1154

Type	Read
Score	56
Start on Template	107
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1161

Type	Read
Score	55
Start on Template	54
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_1238

Type	Read
Score	72
Start on Template	41
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1167

Type	Read
Score	76
Start on Template	42
Length on Template	12
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C690

Type	Read
Score	59
Start on Template	62
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C742_003

Type	Read
Score	41
Start on Template	165
Length on Template	15
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C779_004

Type	Read
Score	49
Start on Template	54
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2934

Type	Read
Score	103
Start on Template	45
Length on Template	18
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1179

Type	Read
Score	54
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1185

Type	Read
Score	42
Start on Template	94
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1518_002

Type	Read
Score	47
Start on Template	112
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1189

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1198

Type	Read
Score	29
Start on Template	205
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1213

Type	Read
Score	114
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C2149_003

Type	Read
Score	38
Start on Template	19
Length on Template	11
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2670_003

Type	Read
Score	44
Start on Template	19
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2680

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3010_002

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C481_005

Type	Read
Score	37
Start on Template	45
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C489_007

Type	Read
Score	62
Start on Template	45
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1885

Type	Read
Score	59
Start on Template	62
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C874_002

Type	Read
Score	73
Start on Template	45
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1380_005

Type	Read
Score	39
Start on Template	19
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1267

Type	Read
Score	41
Start on Template	116
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3141

Type	Read
Score	30
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1814

Type	Read
Score	44
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2158_003

Type	Read
Score	105
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C2416

Type	Read
Score	37
Start on Template	15
Length on Template	15
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2893_002

Type	Read
Score	41
Start on Template	125
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C3031

Type	Read
Score	54
Start on Template	134
Length on Template	37
Start on Read	0
Length of Read	25
Positional Score
Alignment graphic

C3184

Type	Read
Score	46
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C3195

Type	Read
Score	51
Start on Template	119
Length on Template	27
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C3203

Type	Read
Score	61
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C3257

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2914

Type	Read
Score	33
Start on Template	188
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1306

Type	Read
Score	35
Start on Template	181
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2986

Type	Read
Score	30
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1311

Type	Read
Score	34
Start on Template	102
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C277_007

Type	Read
Score	34
Start on Template	131
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C304_003

Type	Read
Score	35
Start on Template	68
Length on Template	17
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2832

Type	Read
Score	64
Start on Template	103
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_1244

Type	Read
Score	36
Start on Template	123
Length on Template	15
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C686_008

Type	Read
Score	40
Start on Template	45
Length on Template	21
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2041

Type	Read
Score	78
Start on Template	103
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_1334

Type	Read
Score	78
Start on Template	103
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C981_003

Type	Read
Score	72
Start on Template	45
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_1354

Type	Read
Score	29
Start on Template	27
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1464_004

Type	Read
Score	35
Start on Template	27
Length on Template	12
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1465_003

Type	Read
Score	40
Start on Template	96
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1579_005

Type	Read
Score	45
Start on Template	133
Length on Template	22
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_2905

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1368

Type	Read
Score	43
Start on Template	47
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2854

Type	Read
Score	87
Start on Template	62
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C2250

Type	Read
Score	99
Start on Template	120
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_2616

Type	Read
Score	56
Start on Template	13
Length on Template	23
Start on Read	0
Length of Read	24
Positional Score
Alignment graphic

C2486_002

Type	Read
Score	35
Start on Template	142
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C2511

Type	Read
Score	48
Start on Template	121
Length on Template	16
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C2605

Type	Read
Score	37
Start on Template	138
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C253_010

Type	Read
Score	32
Start on Template	53
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C308_010

Type	Read
Score	32
Start on Template	131
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C405_005

Type	Read
Score	72
Start on Template	41
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1527

Type	Read
Score	62
Start on Template	125
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C763_005

Type	Read
Score	55
Start on Template	62
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2547

Type	Read
Score	32
Start on Template	131
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C996_002

Type	Read
Score	75
Start on Template	45
Length on Template	14
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1144_004

Type	Read
Score	49
Start on Template	117
Length on Template	24
Start on Read	0
Length of Read	22
Positional Score
Alignment graphic

Combined_1996

Type	Read
Score	80
Start on Template	103
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1678_002

Type	Read
Score	51
Start on Template	106
Length on Template	19
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3269

Type	Read
Score	39
Start on Template	25
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1975

Type	Read
Score	48
Start on Template	11
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2589_002

Type	Read
Score	55
Start on Template	121
Length on Template	15
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_3258

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3195

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C3346

Type	Read
Score	42
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2975

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C3351

Type	Read
Score	41
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C3373

Type	Read
Score	40
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C3399

Type	Read
Score	52
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C3404

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C3413

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C3414

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C3416

Type	Read
Score	45
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2690

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C874_004

Type	Read
Score	65
Start on Template	104
Length on Template	14
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1305

Type	Read
Score	124
Start on Template	143
Length on Template	17
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C501_006

Type	Read
Score	46
Start on Template	140
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C741_005

Type	Read
Score	44
Start on Template	69
Length on Template	15
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3976

Type	Read
Score	107
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C663_005

Type	Read
Score	89
Start on Template	117
Length on Template	25
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C789_007

Type	Read
Score	101
Start on Template	117
Length on Template	20
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C893_006

Type	Read
Score	91
Start on Template	117
Length on Template	21
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C895_005

Type	Read
Score	70
Start on Template	121
Length on Template	14
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C400_006

Type	Read
Score	94
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C462_007

Type	Read
Score	40
Start on Template	152
Length on Template	15
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1190_009

Type	Read
Score	126
Start on Template	84
Length on Template	26
Start on Read	0
Length of Read	27
Positional Score
Alignment graphic

C916_005

Type	Read
Score	114
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1239_004

Type	Read
Score	46
Start on Template	100
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1355_007

Type	Read
Score	41
Start on Template	95
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C331_007

Type	Read
Score	92
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C91_012

Type	Read
Score	31
Start on Template	188
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1725

Type	Read
Score	31
Start on Template	209
Length on Template	6
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1564

Type	Read
Score	32
Start on Template	204
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C197_007

Type	Read
Score	55
Start on Template	200
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C353_012

Type	Read
Score	40
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1579

Type	Read
Score	29
Start on Template	110
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1592

Type	Read
Score	29
Start on Template	26
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C516_006

Type	Read
Score	35
Start on Template	129
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_1593

Type	Read
Score	29
Start on Template	8
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1605

Type	Read
Score	72
Start on Template	52
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C817_006

Type	Read
Score	40
Start on Template	26
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C934_002

Type	Read
Score	75
Start on Template	94
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_1626

Type	Read
Score	39
Start on Template	101
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1016_004

Type	Read
Score	80
Start on Template	45
Length on Template	33
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_1757

Type	Read
Score	96
Start on Template	49
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1107_003

Type	Read
Score	84
Start on Template	49
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1154_004

Type	Read
Score	76
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1646

Type	Read
Score	34
Start on Template	24
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1218_004

Type	Read
Score	108
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1648

Type	Read
Score	33
Start on Template	123
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1264_003

Type	Read
Score	117
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1292_005

Type	Read
Score	48
Start on Template	19
Length on Template	19
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C1343_005

Type	Read
Score	134
Start on Template	119
Length on Template	19
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1402_004

Type	Read
Score	48
Start on Template	48
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1660

Type	Read
Score	31
Start on Template	26
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_1665

Type	Read
Score	36
Start on Template	145
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1676

Type	Read
Score	97
Start on Template	182
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_1541

Type	Read
Score	120
Start on Template	182
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1797_006

Type	Read
Score	107
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1930_003

Type	Read
Score	116
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C2171_003

Type	Read
Score	68
Start on Template	80
Length on Template	30
Start on Read	0
Length of Read	29
Positional Score
Alignment graphic

C2411_002

Type	Read
Score	81
Start on Template	82
Length on Template	28
Start on Read	0
Length of Read	29
Positional Score
Alignment graphic

C2472

Type	Read
Score	61
Start on Template	121
Length on Template	14
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C2572_003

Type	Read
Score	95
Start on Template	142
Length on Template	18
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C2630_002

Type	Read
Score	103
Start on Template	117
Length on Template	20
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C189_012

Type	Read
Score	64
Start on Template	200
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C354_010

Type	Read
Score	45
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_1739

Type	Read
Score	37
Start on Template	159
Length on Template	15
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1746

Type	Read
Score	50
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C867_003

Type	Read
Score	41
Start on Template	101
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1030_005

Type	Read
Score	82
Start on Template	45
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1111_003

Type	Read
Score	75
Start on Template	49
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1125_007

Type	Read
Score	71
Start on Template	47
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1760

Type	Read
Score	76
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1174_005

Type	Read
Score	36
Start on Template	60
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1256_008

Type	Read
Score	31
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1266_004

Type	Read
Score	91
Start on Template	48
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1275_004

Type	Read
Score	107
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1928_005

Type	Read
Score	117
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1971_005

Type	Read
Score	111
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	22
Positional Score
Alignment graphic

C2146_005

Type	Read
Score	91
Start on Template	84
Length on Template	26
Start on Read	0
Length of Read	28
Positional Score
Alignment graphic

C2354_005

Type	Read
Score	91
Start on Template	84
Length on Template	26
Start on Read	0
Length of Read	28
Positional Score
Alignment graphic

C2547_002

Type	Read
Score	105
Start on Template	139
Length on Template	21
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C2550_003

Type	Read
Score	88
Start on Template	142
Length on Template	18
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C162_007

Type	Read
Score	38
Start on Template	63
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C187_009

Type	Read
Score	37
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C248_007

Type	Read
Score	55
Start on Template	200
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C300_005

Type	Read
Score	32
Start on Template	131
Length on Template	7
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C313_005

Type	Read
Score	55
Start on Template	147
Length on Template	21
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C477_010

Type	Read
Score	56
Start on Template	147
Length on Template	20
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_3667

Type	Read
Score	32
Start on Template	142
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C829_009

Type	Read
Score	45
Start on Template	2
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C867_004

Type	Read
Score	41
Start on Template	101
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C937_003

Type	Read
Score	34
Start on Template	138
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C949_007

Type	Read
Score	41
Start on Template	191
Length on Template	14
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1050_006

Type	Read
Score	40
Start on Template	49
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1288_006

Type	Read
Score	114
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_2386

Type	Read
Score	36
Start on Template	89
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1367_003

Type	Read
Score	117
Start on Template	121
Length on Template	17
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1414_004

Type	Read
Score	31
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1420_007

Type	Read
Score	118
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1425_005

Type	Read
Score	58
Start on Template	50
Length on Template	9
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1547_004

Type	Read
Score	34
Start on Template	123
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1629_004

Type	Read
Score	36
Start on Template	145
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1872_009

Type	Read
Score	50
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1986_003

Type	Read
Score	89
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C2175_002

Type	Read
Score	75
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C2179_004

Type	Read
Score	126
Start on Template	84
Length on Template	26
Start on Read	0
Length of Read	27
Positional Score
Alignment graphic

C2379_003

Type	Read
Score	117
Start on Template	84
Length on Template	26
Start on Read	0
Length of Read	27
Positional Score
Alignment graphic

C2440_002

Type	Read
Score	42
Start on Template	139
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2635

Type	Read
Score	116
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C746_006

Type	Read
Score	42
Start on Template	178
Length on Template	15
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2476

Type	Read
Score	38
Start on Template	1
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1474_006

Type	Read
Score	51
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3906

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1826

Type	Read
Score	46
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1838

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1830

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_1877

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1851

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2248_004

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2250_004

Type	Read
Score	57
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2283_005

Type	Read
Score	45
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2286_003

Type	Read
Score	42
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C588_005

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2537

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C918_006

Type	Read
Score	47
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3272

Type	Read
Score	46
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3181

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1924

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C663_006

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C929_005

Type	Read
Score	47
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C956_008

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2920

Type	Read
Score	36
Start on Template	47
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_1946

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1534_008

Type	Read
Score	47
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1059_005

Type	Read
Score	43
Start on Template	204
Length on Template	16
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1208_005

Type	Read
Score	48
Start on Template	113
Length on Template	30
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

C1282_007

Type	Read
Score	53
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1336_007

Type	Read
Score	42
Start on Template	139
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1402_006

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2021

Type	Read
Score	39
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1477_005

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1854

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1616_007

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1667_004

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C602_009

Type	Read
Score	29
Start on Template	4
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C685_009

Type	Read
Score	40
Start on Template	18
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2048

Type	Read
Score	44
Start on Template	9
Length on Template	21
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1108_005

Type	Read
Score	39
Start on Template	125
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1235_007

Type	Read
Score	41
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1371_006

Type	Read
Score	51
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1377_006

Type	Read
Score	43
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2613

Type	Read
Score	35
Start on Template	138
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2531

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1795_006

Type	Read
Score	40
Start on Template	0
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1950

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1879_006

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2580

Type	Read
Score	76
Start on Template	43
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C370_009

Type	Read
Score	39
Start on Template	185
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_1903

Type	Read
Score	38
Start on Template	4
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_1932

Type	Read
Score	53
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_1906

Type	Read
Score	43
Start on Template	94
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C686_013

Type	Read
Score	87
Start on Template	107
Length on Template	18
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_1972

Type	Read
Score	60
Start on Template	1
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1556_005

Type	Read
Score	49
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1702_006

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C138_010

Type	Read
Score	63
Start on Template	41
Length on Template	14
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_1994

Type	Read
Score	53
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C545_007

Type	Read
Score	87
Start on Template	107
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C549_009

Type	Read
Score	70
Start on Template	103
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C606_006

Type	Read
Score	48
Start on Template	9
Length on Template	20
Start on Read	0
Length of Read	23
Positional Score
Alignment graphic

C990_006

Type	Read
Score	51
Start on Template	116
Length on Template	9
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1266_005

Type	Read
Score	46
Start on Template	1
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1466_006

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2068_006

Type	Read
Score	40
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2070_005

Type	Read
Score	36
Start on Template	52
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2023

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2022

Type	Read
Score	44
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2324_004

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2337_003

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2383_003

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C617_005

Type	Read
Score	94
Start on Template	105
Length on Template	20
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_2960

Type	Read
Score	47
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1225_006

Type	Read
Score	62
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_2529

Type	Read
Score	39
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1502_007

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1518_006

Type	Read
Score	42
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2066

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C86_012

Type	Read
Score	36
Start on Template	107
Length on Template	11
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C274_010

Type	Read
Score	41
Start on Template	123
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2052

Type	Read
Score	82
Start on Template	42
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C814_007

Type	Read
Score	86
Start on Template	107
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C820_009

Type	Read
Score	80
Start on Template	107
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_2059

Type	Read
Score	52
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1284_003

Type	Read
Score	72
Start on Template	61
Length on Template	19
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1340_006

Type	Read
Score	68
Start on Template	1
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2571

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2815

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1985_005

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3273

Type	Read
Score	43
Start on Template	54
Length on Template	9
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_2053

Type	Read
Score	86
Start on Template	107
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C809_008

Type	Read
Score	44
Start on Template	2
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2859

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2062_004

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2298_005

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C432_008

Type	Read
Score	59
Start on Template	62
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C738_005

Type	Read
Score	44
Start on Template	84
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C816_007

Type	Read
Score	36
Start on Template	7
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2526

Type	Read
Score	40
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1858_006

Type	Read
Score	38
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2131

Type	Read
Score	36
Start on Template	141
Length on Template	15
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2213

Type	Read
Score	34
Start on Template	89
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2140

Type	Read
Score	44
Start on Template	49
Length on Template	15
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C852_010

Type	Read
Score	32
Start on Template	20
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2268

Type	Read
Score	31
Start on Template	152
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1240_008

Type	Read
Score	35
Start on Template	141
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2312

Type	Read
Score	34
Start on Template	16
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2216

Type	Read
Score	44
Start on Template	46
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3702

Type	Read
Score	35
Start on Template	16
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C106_008

Type	Read
Score	33
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1569_005

Type	Read
Score	35
Start on Template	11
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2274

Type	Read
Score	29
Start on Template	141
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_2313

Type	Read
Score	34
Start on Template	16
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C777_008

Type	Read
Score	34
Start on Template	46
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1517_007

Type	Read
Score	46
Start on Template	145
Length on Template	14
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_3281

Type	Read
Score	38
Start on Template	56
Length on Template	14
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C648_006

Type	Read
Score	37
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1564_009

Type	Read
Score	108
Start on Template	120
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C748_006

Type	Read
Score	73
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C984_006

Type	Read
Score	42
Start on Template	119
Length on Template	21
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1176_007

Type	Read
Score	42
Start on Template	122
Length on Template	20
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C137_008

Type	Read
Score	33
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C261_012

Type	Read
Score	59
Start on Template	147
Length on Template	21
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

Combined_2418

Type	Read
Score	40
Start on Template	121
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2426

Type	Read
Score	36
Start on Template	88
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1452_010

Type	Read
Score	38
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1624_006

Type	Read
Score	29
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1770_005

Type	Read
Score	40
Start on Template	141
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2442

Type	Read
Score	46
Start on Template	147
Length on Template	21
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C1297_005

Type	Read
Score	31
Start on Template	26
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1427_007

Type	Read
Score	82
Start on Template	101
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1518_008

Type	Read
Score	46
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1900_006

Type	Read
Score	61
Start on Template	121
Length on Template	14
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C127_009

Type	Read
Score	40
Start on Template	16
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C653_004

Type	Read
Score	37
Start on Template	160
Length on Template	14
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1069_008

Type	Read
Score	42
Start on Template	56
Length on Template	19
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1139_009

Type	Read
Score	39
Start on Template	134
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1289_007

Type	Read
Score	78
Start on Template	123
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1336_011

Type	Read
Score	100
Start on Template	101
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1467_009

Type	Read
Score	74
Start on Template	148
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1809_005

Type	Read
Score	86
Start on Template	119
Length on Template	16
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_2501

Type	Read
Score	27
Start on Template	138
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C758_010

Type	Read
Score	51
Start on Template	18
Length on Template	17
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_2568

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1787_008

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1793_005

Type	Read
Score	53
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1884_008

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1974_008

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2620

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2536

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2183_005

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2541

Type	Read
Score	43
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2321_005

Type	Read
Score	43
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2326_003

Type	Read
Score	41
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2626

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C335_016

Type	Read
Score	43
Start on Template	18
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1271_012

Type	Read
Score	39
Start on Template	15
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1529_008

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1653_006

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1714_008

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2622

Type	Read
Score	42
Start on Template	137
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2862

Type	Read
Score	58
Start on Template	0
Length on Template	18
Start on Read	10
Length of Read	17
Positional Score
Alignment graphic

C2021_006

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2043_005

Type	Read
Score	48
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2684

Type	Read
Score	57
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2191_003

Type	Read
Score	38
Start on Template	138
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3182

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C44_013

Type	Read
Score	31
Start on Template	47
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C92_018

Type	Read
Score	33
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C286_012

Type	Read
Score	32
Start on Template	4
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C487_008

Type	Read
Score	31
Start on Template	27
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C546_016

Type	Read
Score	58
Start on Template	147
Length on Template	20
Start on Read	0
Length of Read	28
Positional Score
Alignment graphic

C869_012

Type	Read
Score	46
Start on Template	6
Length on Template	19
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C1057_010

Type	Read
Score	44
Start on Template	12
Length on Template	14
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_2607

Type	Read
Score	27
Start on Template	138
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_2735

Type	Read
Score	39
Start on Template	19
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1836_006

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3177

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2199_004

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2749

Type	Read
Score	42
Start on Template	137
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3821

Type	Read
Score	37
Start on Template	135
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2624

Type	Read
Score	39
Start on Template	136
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2625

Type	Read
Score	35
Start on Template	142
Length on Template	7
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C2449_003

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2475

Type	Read
Score	46
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C2509

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2526_004

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_2760

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C89_015

Type	Read
Score	29
Start on Template	103
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_2644

Type	Read
Score	40
Start on Template	1
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2647

Type	Read
Score	49
Start on Template	54
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2784

Type	Read
Score	35
Start on Template	58
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_2900

Type	Read
Score	59
Start on Template	81
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1457_009

Type	Read
Score	50
Start on Template	141
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2669

Type	Read
Score	43
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C2004_006

Type	Read
Score	44
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2111_004

Type	Read
Score	64
Start on Template	114
Length on Template	32
Start on Read	0
Length of Read	28
Positional Score
Alignment graphic

C2522_004

Type	Read
Score	57
Start on Template	138
Length on Template	27
Start on Read	0
Length of Read	26
Positional Score
Alignment graphic

Combined_2753

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2556

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2568

Type	Read
Score	48
Start on Template	135
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2686

Type	Read
Score	42
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_2758

Type	Read
Score	52
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2727_004

Type	Read
Score	52
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C2728_002

Type	Read
Score	42
Start on Template	119
Length on Template	27
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2738

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3229

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2688

Type	Read
Score	40
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3049

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2768

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2691

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_2692

Type	Read
Score	40
Start on Template	133
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_2693

Type	Read
Score	38
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2802

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2809

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3100

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3101

Type	Read
Score	43
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_2982

Type	Read
Score	38
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C98_018

Type	Read
Score	34
Start on Template	22
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3054

Type	Read
Score	27
Start on Template	138
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C347_014

Type	Read
Score	34
Start on Template	185
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C959_008

Type	Read
Score	47
Start on Template	133
Length on Template	21
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_2777

Type	Read
Score	54
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1793_006

Type	Read
Score	43
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2574_004

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2696_002

Type	Read
Score	32
Start on Template	138
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3144

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C2753_003

Type	Read
Score	46
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2913

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2818

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2755

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2867

Type	Read
Score	34
Start on Template	9
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2757

Type	Read
Score	53
Start on Template	129
Length on Template	29
Start on Read	0
Length of Read	26
Positional Score
Alignment graphic

C2880_004

Type	Read
Score	40
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2891_002

Type	Read
Score	45
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3042

Type	Read
Score	57
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2981

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_2762

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C55_013

Type	Read
Score	35
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C342_017

Type	Read
Score	42
Start on Template	47
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_2988

Type	Read
Score	29
Start on Template	20
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C890_011

Type	Read
Score	49
Start on Template	117
Length on Template	24
Start on Read	0
Length of Read	22
Positional Score
Alignment graphic

Combined_3189

Type	Read
Score	34
Start on Template	134
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1667_008

Type	Read
Score	29
Start on Template	140
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1702_008

Type	Read
Score	39
Start on Template	11
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3083

Type	Read
Score	58
Start on Template	140
Length on Template	18
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3044

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3103

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C424_009

Type	Read
Score	53
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C519_008

Type	Read
Score	44
Start on Template	84
Length on Template	19
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_2803

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1439_009

Type	Read
Score	42
Start on Template	142
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1524_007

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1568_010

Type	Read
Score	45
Start on Template	143
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1693_011

Type	Read
Score	39
Start on Template	12
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1816_009

Type	Read
Score	123
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_3027

Type	Read
Score	27
Start on Template	138
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1944_009

Type	Read
Score	39
Start on Template	15
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3907

Type	Read
Score	36
Start on Template	142
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C2566_004

Type	Read
Score	42
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2689_002

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2869

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2803_002

Type	Read
Score	55
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3251

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2872_003

Type	Read
Score	53
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C191_014

Type	Read
Score	30
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_2879

Type	Read
Score	54
Start on Template	0
Length on Template	9
Start on Read	2
Length of Read	8
Positional Score
Alignment graphic

C439_012

Type	Read
Score	39
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_2928

Type	Read
Score	66
Start on Template	42
Length on Template	12
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_2881

Type	Read
Score	64
Start on Template	105
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_2991

Type	Read
Score	73
Start on Template	48
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3810

Type	Read
Score	49
Start on Template	54
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1281_010

Type	Read
Score	50
Start on Template	18
Length on Template	23
Start on Read	0
Length of Read	25
Positional Score
Alignment graphic

C1430_010

Type	Read
Score	46
Start on Template	112
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_2901

Type	Read
Score	43
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C2076_005

Type	Read
Score	111
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

Combined_3203

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2903

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2946_004

Type	Read
Score	51
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C394_014

Type	Read
Score	31
Start on Template	135
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3207

Type	Read
Score	47
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_3879

Type	Read
Score	35
Start on Template	8
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C594_013

Type	Read
Score	48
Start on Template	152
Length on Template	19
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

Combined_2931

Type	Read
Score	115
Start on Template	43
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1304_012

Type	Read
Score	58
Start on Template	7
Length on Template	21
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C1567_009

Type	Read
Score	33
Start on Template	26
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3902

Type	Read
Score	44
Start on Template	132
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2134_007

Type	Read
Score	44
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2211_003

Type	Read
Score	102
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_2971

Type	Read
Score	42
Start on Template	137
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2699_005

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3047

Type	Read
Score	39
Start on Template	70
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2860_003

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3058

Type	Read
Score	38
Start on Template	54
Length on Template	9
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C298_013

Type	Read
Score	67
Start on Template	44
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C362_011

Type	Read
Score	34
Start on Template	62
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C510_009

Type	Read
Score	27
Start on Template	138
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1184_012

Type	Read
Score	51
Start on Template	45
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1223_009

Type	Read
Score	42
Start on Template	129
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3076

Type	Read
Score	36
Start on Template	141
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1616_009

Type	Read
Score	72
Start on Template	47
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1793_007

Type	Read
Score	49
Start on Template	142
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3045

Type	Read
Score	40
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2867_004

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2902

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2954_003

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2993_003

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C148_015

Type	Read
Score	35
Start on Template	188
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3825

Type	Read
Score	35
Start on Template	58
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C537_009

Type	Read
Score	28
Start on Template	107
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C901_008

Type	Read
Score	39
Start on Template	137
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C923_012

Type	Read
Score	100
Start on Template	41
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3075

Type	Read
Score	56
Start on Template	46
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1330_008

Type	Read
Score	114
Start on Template	94
Length on Template	20
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C1591_007

Type	Read
Score	63
Start on Template	69
Length on Template	17
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C2773

Type	Read
Score	38
Start on Template	138
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2820_004

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2853_003

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3098

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2903_002

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2939_005

Type	Read
Score	43
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3158

Type	Read
Score	41
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C3100_005

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3619

Type	Read
Score	72
Start on Template	105
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C517_017

Type	Read
Score	46
Start on Template	105
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C573_013

Type	Read
Score	40
Start on Template	53
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C614_016

Type	Read
Score	34
Start on Template	131
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C682_013

Type	Read
Score	88
Start on Template	43
Length on Template	18
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C839_009

Type	Read
Score	116
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1183_009

Type	Read
Score	58
Start on Template	160
Length on Template	23
Start on Read	0
Length of Read	24
Positional Score
Alignment graphic

C1273_012

Type	Read
Score	96
Start on Template	94
Length on Template	20
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C1288_010

Type	Read
Score	47
Start on Template	10
Length on Template	20
Start on Read	0
Length of Read	22
Positional Score
Alignment graphic

C1374_009

Type	Read
Score	39
Start on Template	84
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1547_007

Type	Read
Score	52
Start on Template	69
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1589_010

Type	Read
Score	54
Start on Template	47
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1746_009

Type	Read
Score	45
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2332_003

Type	Read
Score	44
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2760_004

Type	Read
Score	43
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3202

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C2818_004

Type	Read
Score	40
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2898_002

Type	Read
Score	40
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2914_005

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2975

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2981_002

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2994_003

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3206

Type	Read
Score	39
Start on Template	125
Length on Template	21
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C638_005

Type	Read
Score	44
Start on Template	49
Length on Template	19
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C890_013

Type	Read
Score	52
Start on Template	139
Length on Template	19
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C5_005

Type	Read
Score	34
Start on Template	68
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3665

Type	Read
Score	29
Start on Template	167
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C150_019

Type	Read
Score	75
Start on Template	47
Length on Template	15
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C212_025

Type	Read
Score	92
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C185_016

Type	Read
Score	88
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1009_013

Type	Read
Score	38
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1538_011

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1542_013

Type	Read
Score	38
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3201

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1636_006

Type	Read
Score	43
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3156

Type	Read
Score	54
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_3227

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3196

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C303_013

Type	Read
Score	35
Start on Template	50
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1142_014

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1419_005

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3179

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3224

Type	Read
Score	64
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1500_009

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1515_007

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_3183

Type	Read
Score	57
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1553_011

Type	Read
Score	44
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1571_010

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1581_014

Type	Read
Score	50
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3168

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3169

Type	Read
Score	62
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3250

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1664_011

Type	Read
Score	45
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3184

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C552_014

Type	Read
Score	33
Start on Template	134
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1594_012

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1637_009

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

Combined_3924

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1654_009

Type	Read
Score	41
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1688_005

Type	Read
Score	41
Start on Template	119
Length on Template	27
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1754_006

Type	Read
Score	44
Start on Template	127
Length on Template	16
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3204

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1780_009

Type	Read
Score	50
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3245

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1816_010

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1828_008

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1883_009

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1895_014

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C2101_006

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3555

Type	Read
Score	33
Start on Template	47
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C340_011

Type	Read
Score	40
Start on Template	48
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1967_011

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1968_005

Type	Read
Score	38
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1971_009

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3226

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2080_004

Type	Read
Score	63
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C2140_009

Type	Read
Score	42
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2163_006

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2199_006

Type	Read
Score	49
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1683_009

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1730_006

Type	Read
Score	44
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1800_007

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1811_014

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1837_008

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1890_010

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C1961_008

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1967_012

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1980_009

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3228

Type	Read
Score	57
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2070_009

Type	Read
Score	54
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2073_007

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C311_012

Type	Read
Score	33
Start on Template	152
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1784_009

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2030_005

Type	Read
Score	41
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2081_005

Type	Read
Score	55
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C2260_005

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2295_005

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C474_012

Type	Read
Score	38
Start on Template	184
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3271

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1799_010

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3500

Type	Read
Score	37
Start on Template	142
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C2059_006

Type	Read
Score	42
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2165_006

Type	Read
Score	43
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2180_008

Type	Read
Score	42
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3249

Type	Read
Score	57
Start on Template	125
Length on Template	21
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C2198_005

Type	Read
Score	36
Start on Template	19
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2231_004

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3279

Type	Read
Score	46
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2282_004

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C69_020

Type	Read
Score	29
Start on Template	63
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1838_007

Type	Read
Score	41
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1969_009

Type	Read
Score	41
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1972_005

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2009_009

Type	Read
Score	38
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2012_008

Type	Read
Score	42
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2065_007

Type	Read
Score	41
Start on Template	127
Length on Template	19
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2138_004

Type	Read
Score	55
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2170_005

Type	Read
Score	39
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C2203_009

Type	Read
Score	33
Start on Template	135
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1787_013

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3945

Type	Read
Score	39
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2165_007

Type	Read
Score	39
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C936_014

Type	Read
Score	34
Start on Template	1
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1764_015

Type	Read
Score	44
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2059_008

Type	Read
Score	47
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2132_003

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2148_006

Type	Read
Score	39
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2161_006

Type	Read
Score	38
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C529_018

Type	Read
Score	51
Start on Template	116
Length on Template	9
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C836_013

Type	Read
Score	43
Start on Template	16
Length on Template	22
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3301

Type	Read
Score	37
Start on Template	16
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3351

Type	Read
Score	29
Start on Template	110
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_3352

Type	Read
Score	35
Start on Template	20
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3357

Type	Read
Score	28
Start on Template	141
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C564_012

Type	Read
Score	36
Start on Template	90
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C115_020

Type	Read
Score	34
Start on Template	16
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C322_024

Type	Read
Score	37
Start on Template	15
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C751_016

Type	Read
Score	41
Start on Template	102
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C94_017

Type	Read
Score	29
Start on Template	163
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_3414

Type	Read
Score	42
Start on Template	56
Length on Template	14
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C531_015

Type	Read
Score	40
Start on Template	16
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3422

Type	Read
Score	38
Start on Template	16
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C28_015

Type	Read
Score	34
Start on Template	189
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C209_016

Type	Read
Score	34
Start on Template	99
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C92_025

Type	Read
Score	43
Start on Template	16
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C377_024

Type	Read
Score	44
Start on Template	177
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C879_016

Type	Read
Score	41
Start on Template	44
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3427

Type	Read
Score	34
Start on Template	141
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C129_020

Type	Read
Score	38
Start on Template	16
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C194_022

Type	Read
Score	32
Start on Template	216
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C255_022

Type	Read
Score	34
Start on Template	99
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C668_011

Type	Read
Score	36
Start on Template	141
Length on Template	15
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C587_014

Type	Read
Score	36
Start on Template	0
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C598_013

Type	Read
Score	50
Start on Template	61
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C918_015

Type	Read
Score	39
Start on Template	1
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1061_013

Type	Read
Score	60
Start on Template	188
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1124_010

Type	Read
Score	56
Start on Template	189
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

Combined_3467

Type	Read
Score	29
Start on Template	26
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1785_012

Type	Read
Score	35
Start on Template	134
Length on Template	9
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C1963_011

Type	Read
Score	64
Start on Template	188
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_3494

Type	Read
Score	41
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3861

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1948_010

Type	Read
Score	30
Start on Template	25
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3512

Type	Read
Score	40
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2741_005

Type	Read
Score	37
Start on Template	81
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3501

Type	Read
Score	31
Start on Template	120
Length on Template	5
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C851_015

Type	Read
Score	31
Start on Template	47
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1254_013

Type	Read
Score	29
Start on Template	131
Length on Template	6
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1701_011

Type	Read
Score	35
Start on Template	162
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3530

Type	Read
Score	29
Start on Template	142
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C3167_003

Type	Read
Score	34
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C3180

Type	Read
Score	42
Start on Template	135
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3499

Type	Read
Score	36
Start on Template	142
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C969_012

Type	Read
Score	34
Start on Template	26
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C2546_006

Type	Read
Score	43
Start on Template	139
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3796

Type	Read
Score	34
Start on Template	17
Length on Template	13
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C1494_014

Type	Read
Score	47
Start on Template	0
Length on Template	11
Start on Read	5
Length of Read	10
Positional Score
Alignment graphic

C1710_011

Type	Read
Score	40
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C1759_012

Type	Read
Score	37
Start on Template	142
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_3544

Type	Read
Score	50
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C928_008

Type	Read
Score	35
Start on Template	164
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1015_016

Type	Read
Score	68
Start on Template	103
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1520_013

Type	Read
Score	32
Start on Template	95
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

Combined_3595

Type	Read
Score	54
Start on Template	61
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C557_013

Type	Read
Score	38
Start on Template	107
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C765_012

Type	Read
Score	37
Start on Template	96
Length on Template	15
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C920_016

Type	Read
Score	31
Start on Template	27
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3563

Type	Read
Score	29
Start on Template	96
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1515_009

Type	Read
Score	49
Start on Template	69
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1851_015

Type	Read
Score	41
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3570

Type	Read
Score	68
Start on Template	103
Length on Template	11
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C972_015

Type	Read
Score	40
Start on Template	27
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3581

Type	Read
Score	29
Start on Template	96
Length on Template	7
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C1780_012

Type	Read
Score	41
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C418_016

Type	Read
Score	42
Start on Template	41
Length on Template	12
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C627_012

Type	Read
Score	66
Start on Template	103
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C772_014

Type	Read
Score	61
Start on Template	125
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3575

Type	Read
Score	44
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C836_015

Type	Read
Score	37
Start on Template	4
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C1095_012

Type	Read
Score	43
Start on Template	189
Length on Template	22
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1275_013

Type	Read
Score	37
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1296_012

Type	Read
Score	41
Start on Template	116
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3582

Type	Read
Score	61
Start on Template	125
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1331_007

Type	Read
Score	53
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3605

Type	Read
Score	68
Start on Template	103
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1601_019

Type	Read
Score	35
Start on Template	64
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C623_012

Type	Read
Score	37
Start on Template	10
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3597

Type	Read
Score	60
Start on Template	69
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C785_019

Type	Read
Score	44
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3630

Type	Read
Score	49
Start on Template	62
Length on Template	7
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

Combined_3604

Type	Read
Score	37
Start on Template	68
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1377_013

Type	Read
Score	41
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1498_012

Type	Read
Score	79
Start on Template	103
Length on Template	10
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1546_007

Type	Read
Score	60
Start on Template	108
Length on Template	17
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1552_009

Type	Read
Score	76
Start on Template	45
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3636

Type	Read
Score	51
Start on Template	124
Length on Template	10
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1873_012

Type	Read
Score	76
Start on Template	69
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C454_021

Type	Read
Score	35
Start on Template	125
Length on Template	17
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C625_019

Type	Read
Score	48
Start on Template	59
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C978_012

Type	Read
Score	43
Start on Template	117
Length on Template	8
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1071_012

Type	Read
Score	52
Start on Template	46
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C1280_008

Type	Read
Score	71
Start on Template	42
Length on Template	19
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1509_004

Type	Read
Score	62
Start on Template	125
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1737_007

Type	Read
Score	35
Start on Template	27
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1865_011

Type	Read
Score	41
Start on Template	116
Length on Template	9
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1870_015

Type	Read
Score	88
Start on Template	69
Length on Template	11
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C1877_016

Type	Read
Score	35
Start on Template	4
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3664

Type	Read
Score	116
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C4_007

Type	Read
Score	42
Start on Template	1
Length on Template	8
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C233_026

Type	Read
Score	80
Start on Template	47
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3967

Type	Read
Score	128
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C50_024

Type	Read
Score	38
Start on Template	56
Length on Template	14
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3680

Type	Read
Score	34
Start on Template	16
Length on Template	12
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C369_019

Type	Read
Score	39
Start on Template	16
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3724

Type	Read
Score	35
Start on Template	89
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3686

Type	Read
Score	34
Start on Template	105
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

Combined_3729

Type	Read
Score	48
Start on Template	44
Length on Template	15
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C133_019

Type	Read
Score	38
Start on Template	56
Length on Template	14
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C209_018

Type	Read
Score	37
Start on Template	65
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

Combined_3769

Type	Read
Score	35
Start on Template	16
Length on Template	16
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C592_013

Type	Read
Score	41
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C809_025

Type	Read
Score	44
Start on Template	44
Length on Template	21
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C35_020

Type	Read
Score	34
Start on Template	197
Length on Template	9
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C576_017

Type	Read
Score	38
Start on Template	134
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C111_026

Type	Read
Score	35
Start on Template	209
Length on Template	9
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C199_018

Type	Read
Score	38
Start on Template	20
Length on Template	8
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

Combined_3871

Type	Read
Score	45
Start on Template	133
Length on Template	22
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

C1264_008

Type	Read
Score	47
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3803

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1675_010

Type	Read
Score	41
Start on Template	137
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1736_013

Type	Read
Score	45
Start on Template	135
Length on Template	14
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3908

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1847_010

Type	Read
Score	48
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1484_014

Type	Read
Score	38
Start on Template	12
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3822

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1836_011

Type	Read
Score	57
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C636_015

Type	Read
Score	51
Start on Template	18
Length on Template	17
Start on Read	0
Length of Read	20
Positional Score
Alignment graphic

Combined_3843

Type	Read
Score	39
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1640_012

Type	Read
Score	37
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3844

Type	Read
Score	48
Start on Template	132
Length on Template	14
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C147_024

Type	Read
Score	40
Start on Template	8
Length on Template	12
Start on Read	0
Length of Read	11
Positional Score
Alignment graphic

C255_026

Type	Read
Score	59
Start on Template	163
Length on Template	17
Start on Read	0
Length of Read	17
Positional Score
Alignment graphic

Combined_3850

Type	Read
Score	48
Start on Template	133
Length on Template	22
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

Combined_3860

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C468_020

Type	Read
Score	41
Start on Template	145
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C962_013

Type	Read
Score	39
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

Combined_3886

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1073_013

Type	Read
Score	35
Start on Template	29
Length on Template	10
Start on Read	0
Length of Read	10
Positional Score
Alignment graphic

C1514_015

Type	Read
Score	39
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1693_015

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C88_024

Type	Read
Score	37
Start on Template	57
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C617_016

Type	Read
Score	42
Start on Template	54
Length on Template	19
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C1023_014

Type	Read
Score	43
Start on Template	129
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1367_007

Type	Read
Score	67
Start on Template	125
Length on Template	21
Start on Read	0
Length of Read	28
Positional Score
Alignment graphic

C621_020

Type	Read
Score	36
Start on Template	202
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1256_015

Type	Read
Score	34
Start on Template	134
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C1585_014

Type	Read
Score	67
Start on Template	119
Length on Template	27
Start on Read	0
Length of Read	28
Positional Score
Alignment graphic

C1740_009

Type	Read
Score	39
Start on Template	187
Length on Template	22
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1957_017

Type	Read
Score	39
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2038_008

Type	Read
Score	40
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

Combined_3909

Type	Read
Score	44
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C153_021

Type	Read
Score	43
Start on Template	54
Length on Template	8
Start on Read	0
Length of Read	8
Positional Score
Alignment graphic

C460_018

Type	Read
Score	92
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C876_019

Type	Read
Score	50
Start on Template	108
Length on Template	17
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1482_014

Type	Read
Score	123
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1585_015

Type	Read
Score	41
Start on Template	128
Length on Template	18
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1839_015

Type	Read
Score	62
Start on Template	139
Length on Template	32
Start on Read	0
Length of Read	27
Positional Score
Alignment graphic

C1882_016

Type	Read
Score	40
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C14_016

Type	Read
Score	29
Start on Template	105
Length on Template	5
Start on Read	0
Length of Read	7
Positional Score
Alignment graphic

C971_019

Type	Read
Score	43
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

Combined_3955

Type	Read
Score	123
Start on Template	117
Length on Template	18
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1280_010

Type	Read
Score	42
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C1515_011

Type	Read
Score	45
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C34_016

Type	Read
Score	36
Start on Template	188
Length on Template	9
Start on Read	0
Length of Read	9
Positional Score
Alignment graphic

C605_025

Type	Read
Score	46
Start on Template	162
Length on Template	18
Start on Read	0
Length of Read	21
Positional Score
Alignment graphic

C889_019

Type	Read
Score	117
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	18
Positional Score
Alignment graphic

C1662_013

Type	Read
Score	44
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	12
Positional Score
Alignment graphic

C2062_007

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C560_022

Type	Read
Score	110
Start on Template	45
Length on Template	16
Start on Read	0
Length of Read	16
Positional Score
Alignment graphic

C851_018

Type	Read
Score	115
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	19
Positional Score
Alignment graphic

C1946_016

Type	Read
Score	39
Start on Template	139
Length on Template	10
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C1817_015

Type	Read
Score	39
Start on Template	187
Length on Template	22
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2035_008

Type	Read
Score	48
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Positional Score
Alignment graphic

C2068_013

Type	Read
Score	55
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	15
Positional Score
Alignment graphic

C2073_011

Type	Read
Score	47
Start on Template	136
Length on Template	10
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

C2077_007

Type	Read
Score	56
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	14
Positional Score
Alignment graphic

>REC-0-8_002 template
.DINVMTQTPKSLPVTPGEPASISLRSNTSLLDSDDGNTYLDWYQKQKPGQSPQLLIYQASTRASGVPDRFSGSGYGTDFTFTISPVQAEDLAVYECHQDYSSPLTFGAGTKLEIKGNPKEAAPSVFLFPPSDPALQPALQPVLSGLLSWTYPGAVTVAWKADGSPVVVAGEFDQGSKSSNQKLGASSYLSLTPEQWKSGFSYSCRVTHEGSTVEKSTAANAKT
>C3031 score:54 alignment:2M2D10M3D2M4D8M3D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.A......AQ.WT...L..V..G..LV.S......PG....VWETL.G...LP...GV.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1048_002 score:54 alignment:2M1S[2,1]6M6D17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NH....Q.NV...Q..D..Y..L..........GAVVVAGEFD.Q...GSSKDT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1879_003 score:52 alignment:3I9M4D5M2D7M3D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPGAG.WT...L..V..G..LV........PGAGQ..WTLL.S...TP...GV.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1016_004 score:80 alignment:10M15D2M1D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..L........................GS.YGVDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2111_004 score:64 alignment:10M3D11M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDDHP...ALQPV.....LS..DDDA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1839_015 score:62 alignment:1I3M2I15M5D3M3D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SG.PQWT.L..V..G..LV.SPG...VPGVWTS......G...TP...GV.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2171_003 score:68 alignment:1I1S[1,2]7M2D10M1D9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVQSNLNAT..GHLECH.DYSS..PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1208_005 score:48 alignment:4M10D16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.GEP...............PC..EQPV..LQ.MPA....LQ.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2757 score:53 alignment:1I8M1D1S[2,1]5M2D7M2S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSLEE..HP.AL.....Q.PV...L..N..G.....SPA...LQPVLSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1033_002 score:53 alignment:4M1S[2,2]4M5D8M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.PD...C..G..V..TT.SD........VVVAGEFDQG...SSSKE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2411_002 score:81 alignment:19M1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVQAQVQAVPAED.EHDYSSPLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1399_003 score:50 alignment:4M7D17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPQT...........SDVVVAG.EFDQGSKTSD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_338 score:42 alignment:5M11D3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALMV..................PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1585_014 score:67 alignment:10M2I9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ACDHPAL..QPVLSDDPA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2316 score:60 alignment:4M10D5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAPA................LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3195 score:51 alignment:9M8D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQPVL..SP.............AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2728_002 score:42 alignment:5M11D3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAKNV..................PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2522_004 score:57 alignment:2I11M2D6M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPAG.WT...L..V..G..LV.SW.....PGVPGV.WTTP.G...VY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1688_005 score:41 alignment:5M7D4M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ACPDV...........PA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2379_003 score:117 alignment:1I26M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVYSYH.QDYSS.PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2179_004 score:126 alignment:1I26M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVFYCH.QDYSS.PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1190_009 score:126 alignment:1I26M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVYFCH.QNYSS.PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2354_005 score:91 alignment:1I12M1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVPGEEHEDYSS.PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2146_005 score:91 alignment:1I17M1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVPEQD.EHNYSSPLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1407 score:48 alignment:1I14M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SGC...GSGRVD.....D.M...PGVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C663_005 score:89 alignment:1S[2,3]14M6D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SGVM.............G.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C890_011 score:49 alignment:1I1M1S[2,2]3M2D12M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKA...EAES..L..YQQ..SKYE..LQ.LT.....AG.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1144_004 score:49 alignment:1I1M1S[2,2]3M2D12M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKA...EAES..L..YQS..KYEE..LQ.LT.....AG.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2616 score:56 alignment:1I14M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~TT.SGS..YPSLLQN.VRP.VTLY.SGDGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1183_009 score:58 alignment:10M1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AT.T...SDVVVGVTETDQSTMEKLQKL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1281_010 score:50 alignment:3I4M3D1M1S[1,2]13M1S[1,2] unique:False
~~~~~~~~~~~~~~~~~~~~~LKDAMLS....SGA.SGVS.SPDCDKLVDAM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1740_009 score:39 alignment:6M7D9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YNSLTL.......S.LKLVVTHF~~~~~~~~~~~~~~
>C1579_005 score:45 alignment:2M3D1S[2,1]4M1D10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ........Q.GT...L..P.....LL.SDT...DPGHM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3850 score:48 alignment:2M4D16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ.........G.AA...S..L..P..LL.SDT...DPGHM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C836_013 score:43 alignment:9M7D6M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGSGR.Y.........DLGTAY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3871 score:45 alignment:2M3D1S[2,1]4M1D10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ........Q.AS...L..P.....LL.SDT...DPGHM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C679_004 score:84 alignment:10M5D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..L.............SHSGQPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1095_012 score:43 alignment:4M4D14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGTA....SVVS.STMEVTHQ..GL~~~~~~~~~~~
>C1817_015 score:39 alignment:11M7D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YNSLTLNGQKL........VTHF~~~~~~~~~~~~~~
>C835_005 score:52 alignment:13M2D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDVVVAG.EFDQGS..STNKLGA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C866_002 score:59 alignment:4I3M1D12M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNHNL.QD....YLGAVVVAGEFDQG...SSSKE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1934 score:47 alignment:13M2D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDVVVAG.EFDQGS..STDKLGA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C313_005 score:55 alignment:21M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SET...APAAPAAAPPAA.E...KPVKK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1811 score:58 alignment:2M1S[2,2]6M1D7M1S[2,2]1M unique:False
~~~~~~~~~PL.LSNTD.PGQ...ASLPLL.SNT.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C893_006 score:91 alignment:13M3D1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE...AAPSVFL..FPG..S.....QL.FHK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1367_007 score:67 alignment:6I8M2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDDHPAL..QPV..SDDDPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3206 score:39 alignment:6M5D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..GCP..VP........AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1304_012 score:58 alignment:2M1S[2,2]6M1D7M1S[2,3]1M unique:False
~~~~~~~~~PL.LSSQD.PGQ...ASLPLL.SGGT.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3249 score:57 alignment:5M3D5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..TQP..A.....LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C984_006 score:42 alignment:1I10M7D1M1S[1,2]1S[2,1] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NAAVSVYL..DYP............NAV....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2048 score:44 alignment:13M2D6M unique:False
~~~~~~~~~~~~SDVVV.AGE..FDQGS...SSE.KLQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2547_002 score:105 alignment:21M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.PA...V..T..V..FL.GDY...YPGAVTVAWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1868_002 score:57 alignment:5M3D5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..TLP..A.....LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C261_012 score:59 alignment:21M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SET...APAAPAAAPPAE.K...APKKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2442 score:46 alignment:21M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SET...APAAPAAAPPTV.Q...APKKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2790 score:58 alignment:2M1S[2,2]6M1D7M1S[2,3]1M unique:False
~~~~~~~~~PL.LSNTD.PGQ...ASLPLL.SGGT.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C686_008 score:40 alignment:4M4D3M1S[1,2]2M4D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KMGE........L..LC..AG...AS.......GVS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C809_025 score:44 alignment:15M2D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QASSG.S.PGL..L..RL..V...AQ.....ATGG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1962_002 score:47 alignment:2I10M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVL..QPV..LSPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C959_008 score:47 alignment:3M3D5M1D9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ.A.......G.AS...L..P.....LL.SDT...LRGM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_468 score:45 alignment:9M4D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AD...DEAVLVP.....GSGPGSW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2630_002 score:103 alignment:1S[2,3]12M2D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SD....LQ.EK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1273_012 score:96 alignment:3I5M2D13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NEHCF.YSS...PLTFGAGT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C477_010 score:56 alignment:20M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SET...APAAPAAAPPAA.E...KPVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C418 score:47 alignment:20M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDVVVAG.EFDQTSMQKLQKL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C546_016 score:58 alignment:2I3M3I13M3I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSDDFGADYLGAVVVAGEMD.GAGSSSEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C606_006 score:48 alignment:3I20M unique:False
~~~~~~~~~KETSDVVV.AGE..FDETSEK.ELQ.KL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C617_005 score:94 alignment:1S[3,2]6M3D1S[2,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NAT.KLE.LK....ASV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1176_007 score:42 alignment:7M3D4M1D1M1S[2,1]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ESFG..FSP.....E..LQ.A.K....Q.SF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1330_008 score:114 alignment:1I20M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FCH.QDYSS.PLTFGAGT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1288_010 score:47 alignment:7M2I8M1S[2,2]3M unique:False
~~~~~~~~~~~~~LANT.PTERLPDSLPLL.SNT.CGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C789_007 score:101 alignment:1S[2,2]12M2D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SD....LQ.EK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2981 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPC..VVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1808_003 score:50 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPL..PDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C869_012 score:46 alignment:2I19M unique:False
~~~~~~ANTPL.SCDKP.PLP..LLSNTCG.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1678_002 score:51 alignment:5M6D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ATV.KL........LN...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_346 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPL..YVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2526_004 score:42 alignment:10M3D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PA..LNPA..LQ.PV........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1280_008 score:71 alignment:19M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLQKPGL.S.GPG..L..LQ..P...GG...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1292_005 score:48 alignment:1I1S[2,2]17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~GLSEDT.TEE.TLKE.SFDGSVR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C392_002 score:41 alignment:1I2M4D13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLD....QLNEQ.S.SQP..N..LY..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_597 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVL..PDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C617_016 score:42 alignment:13M3D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...AS...LPLLGNKM....GSG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C890_013 score:52 alignment:14M1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.PV...Y..Q..E..LL.QYQ...EPVLGPVR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C638_005 score:44 alignment:12M1S[3,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PAQ..L..LQ..W...QV...LSSQVPA.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1934_003 score:50 alignment:8M3D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PA..LQPG..LQ........Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C342_017 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GV.S.GCL..L..C.............QASGVS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_482 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY..NVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3103 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPC..GVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2078 score:51 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PC..HDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2079 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PC..PCPV..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C519_008 score:44 alignment:19M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTTSDVVVAGEM.DKYDS.PL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C723 score:89 alignment:15M1S[3,3]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE...AAPSVFL..FPG..AGNL..QE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3203 score:61 alignment:11M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PV..LWPA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2946_004 score:51 alignment:10M3D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PA..LQPA..LQ.PN........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C594_013 score:48 alignment:3I7M1D11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LCAGAGTVSS.AC.A...RPCKPGV.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2180_008 score:42 alignment:10M5D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PP..FVPA..LQ.AF.............L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1343_005 score:134 alignment:19M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAPSVTL..FPP..SSEE..LQ.ANK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_394 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPG..YVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2065_007 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PAL..SSPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1030 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APL..YVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1538_011 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PA..MVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3204 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVL..SFPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2337_003 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PG..NVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1069_008 score:42 alignment:3M3D13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS......SGSPL.RPVLSSVA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1284_003 score:72 alignment:1I4M1D3M1D8M1I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVGV.D.RY.GSGYGTDASTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1985_005 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PG..CVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_336 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY..QVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_397 score:42 alignment:8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PV..MVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1780_009 score:50 alignment:8M3D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PA..LQPV..LQ........Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1085 score:45 alignment:1S[2,1]7M1I1S[2,2]3M1I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGN.ELE.LFVNAAKLD..AAMSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2083 score:42 alignment:3M3D13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS......SGSPV.RPLLSSVA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_440 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPM..HVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1581_014 score:50 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVL..SDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2073_007 score:41 alignment:1I8M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPV..YVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1371_006 score:51 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GP..DDDH..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1816_009 score:123 alignment:1S[2,2]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SDKE..LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2954_003 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SP..RVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C900 score:41 alignment:1I7M3D6M1S[2,1] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSFER..FSP.....E..LQ.ASF....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2869 score:42 alignment:5M3D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..CDVP......AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1962 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VP..AMPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_485 score:39 alignment:1I1S[2,2]5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GS..PVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C686_013 score:87 alignment:1I9M3D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGQ.KLE.LK.TQ......AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1235_007 score:41 alignment:1I5M5D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AP..GYPE............Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2572_003 score:95 alignment:3M2I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..P..GAVYL.ADY...YPGAVTVAWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2158_003 score:105 alignment:1S[2,2]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SNEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1490 score:116 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SDQE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_225 score:126 alignment:18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE...AAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2076_005 score:111 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTV...AAPSVFL..FPP..SEKE..LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3161 score:43 alignment:7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..CVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1377_006 score:43 alignment:7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..CPCH..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2211_003 score:102 alignment:1S[2,2]13M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SDQL..EK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1930_003 score:116 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VSA...AAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1459 score:44 alignment:1I18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HF.FLLADADS.ADA.LL.GNPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2931 score:115 alignment:1I4M1S[2,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KKYQPAN.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1546 score:116 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTV...AAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1889_003 score:46 alignment:3I1S[2,2]5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLS..PDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3083 score:58 alignment:10M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY...Q..V..S..LM.SDL...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1466_006 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MP..PCPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2541 score:43 alignment:7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..YVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1703_003 score:58 alignment:10M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY...Q..V..S..LM.SDV...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1474_006 score:51 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GP..DDHD..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2862 score:58 alignment:1D17M unique:False
~~ LVSNQDTL.VGLVT.PGV..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2635 score:116 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SNEE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_954 score:43 alignment:7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..MVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1277 score:116 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2175_002 score:75 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVML..FGT..MEEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1986_003 score:89 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSL...AAPSVFL..FGV..MDQE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1500_003 score:102 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SEKG..LW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1742_004 score:58 alignment:10M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY...Q..V..S..LF.SDV...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2550_003 score:88 alignment:2I18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASL..P..G..LV.FDY...YPGSVTVVWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2934 score:103 alignment:12M2D1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q........TARS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1045_002 score:40 alignment:2I8M5D1M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LFL..V..S..LG.SDL........TLGMK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2053 score:86 alignment:1I7M3D1S[2,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGQ.KLE.LK....ASV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1971_005 score:111 alignment:1I2M3I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VKELLNAAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1928_005 score:117 alignment:18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE...AAPSVFL..FPP..SDQQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1213 score:114 alignment:1S[2,2]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_171 score:126 alignment:18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE...AAPSVFL..FPP..SDQE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1616_007 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GP..NVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C820_009 score:80 alignment:1I18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSV.KLE.LK.GTVAA...NAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C814_007 score:86 alignment:1I7M3D1S[2,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGQ.KLE.LK....LGS...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2529 score:39 alignment:2I4M1D2M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSP..CDH...LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C545_007 score:87 alignment:1I10M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGQ.KLE.LK.GTV.....AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C981_003 score:72 alignment:18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PGA..L..LP..K...PS...PQAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C501_006 score:46 alignment:7M1I3M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY...Q..V..S..LMGSDV...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3245 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NP..QVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1585_015 score:41 alignment:2I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGP..CPCC..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2012_008 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YP..QVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_427 score:43 alignment:7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..CHPC..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3976 score:107 alignment:1S[2,3]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVFL..FPP..SNEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1482_014 score:123 alignment:1S[2,2]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SDEQ..LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3955 score:123 alignment:1S[2,2]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SDEK..LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1750 score:53 alignment:10M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..ALQA..LM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2854 score:87 alignment:16M1I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVLD.RGYGSGYGTDGSTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C916_005 score:114 alignment:1S[2,2]16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EK...AAPSVFL..FPP..SNEE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3404 score:42 alignment:9M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P..VLSC..SP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C682_013 score:88 alignment:1I4M1S[2,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KKYQPAN.S.PQL..L..LY..Q...KG...TE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1882 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NP..GVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C605_025 score:46 alignment:3I18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVTT...SDVVVAG.EFDQGSKSSE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1239_004 score:46 alignment:12M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F.FGDFGDLS.GSEALL.GNPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3179 score:42 alignment:1I7M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MP..AVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2475 score:46 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVLT..LT.PAL....QH.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1484_014 score:38 alignment:2M4D2M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~VT.......ALVTCA.VQQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C233 score:61 alignment:9M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~SCA.EWE.SLL..SGWGNTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1023 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3258 score:43 alignment:8M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SNQH..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_522 score:52 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1225_006 score:62 alignment:1I9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SMDHP..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C758_010 score:51 alignment:3I7M1S[2,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~LQQASLPLL.SNT.DGNR.SDDS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1030_005 score:82 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..G...SP...SSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1023_014 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASMPV..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3351 score:41 alignment:2I4M3D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTSDVP......AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C874_002 score:73 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LG..N...RP...PAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1227 score:44 alignment:6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SWPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3169 score:62 alignment:1I9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QSLPA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C454_021 score:35 alignment:4M8D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..FPP.............K....GG.PK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3373 score:40 alignment:9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TMTD..HV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_841 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSFPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1869_004 score:63 alignment:9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAPA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1836_006 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSAPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1295 score:41 alignment:2I4M3D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGSDVP......AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1367_003 score:117 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPSVTL..FPP..SSEE..LQ.ANK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_869 score:48 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSDVVVAG.EFDQGSKSTD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C752_004 score:49 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDVVVAG.EFDQGSKSTD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1305 score:124 alignment:3I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPAV..M..LL.SDF...YPGAVTVAWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_975 score:47 alignment:3I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTTSDVVVAG.EFDQGSKDST~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2753 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CSVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1529_008 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSAPV..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2758 score:52 alignment:2M2D5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SD....LH.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2037_002 score:41 alignment:6M1S[3,3]1M1S[2,2]1S[2,1]1M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PY...Q..V..S..FS.DLV...PYQVSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2059 score:52 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSDKD..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C876_019 score:50 alignment:3I4M7D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVT.KLN............AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_731 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSFPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C465 score:43 alignment:4M1S[2,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GN.R.ELQ..N..LL..P...AS...TGAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2449_003 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HSVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3226 score:43 alignment:4M3D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDDP......AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2903_002 score:43 alignment:1I7M4D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MSVPA..LQ.V.........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1374_009 score:39 alignment:8M5D1S[1,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTTSDVGV......VAGEF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_902 score:49 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSDVVVAG.EFDQGSKDST~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1465_003 score:40 alignment:9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ENLER.PASSQQA.SLP.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C304_003 score:35 alignment:8M5D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FSSSGGGP......LSSM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2081_005 score:55 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLPA..LQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3045 score:40 alignment:1I1S[2,2]4M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDSPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1042_003 score:50 alignment:4I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HMTTSDVVVAG.EFDQGSKTSD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1547_007 score:52 alignment:1I3M1D13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSFS.YGTDF.TFTGVPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C255_026 score:59 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDVVVAG.EFDQGSKTSN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1746_009 score:45 alignment:2I2M5D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGSD........DL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2332_003 score:44 alignment:6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SCPV..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_526 score:43 alignment:5M2D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDPV..P...AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2132_003 score:43 alignment:1I7M4D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASMPA..LQ.L.........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2967 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C636_015 score:51 alignment:3I7M1S[2,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~LQQASLPLL.SNT.DGRN.SDDS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1591_007 score:63 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSFGYGTDF.TFTGVPRD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1439_009 score:42 alignment:10M1S[2,1]1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..T..A..LV.SDM...VQQTVAAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1546_007 score:60 alignment:2I9M3D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAQ.KLE.LK.ASQ......APSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1524_007 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGDKD..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2030_005 score:41 alignment:2I4M3D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTSDVP......AL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1568_010 score:45 alignment:9M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V..T..AL.VDG...MVQQTVAAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1693_011 score:39 alignment:2M4D11M unique:False
~~~~~~~~~~~~~~~VT.......ALVSCT.VQQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_552 score:43 alignment:1I6M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QSVPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1972_005 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGW..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1872_009 score:50 alignment:6M1S[2,2]5M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAYA.Q.YLQ..V..LY..Q...AT...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C560_022 score:110 alignment:13M1S[3,3] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q...AT...RS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3967 score:128 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3769 score:35 alignment:7M4D5M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTY......SLLH.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2699_005 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCY..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1059_005 score:43 alignment:5M2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RQTLLVGGSMVEQTLAAN~~
>Combined_422 score:42 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSA.S.DDY..L..LP..S...AS...DDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_038 score:101 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LT..Q...FS...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1282_007 score:53 alignment:6M1D1M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DWV..LN.L.K....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1667_004 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DMQ..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3664 score:116 alignment:2M1S[2,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPQG.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1793_007 score:49 alignment:2I8M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLQ..V..S..LM.SDL...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3224 score:64 alignment:8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DHA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1793_005 score:53 alignment:1I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KDCE..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1787_008 score:44 alignment:2I8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDDHP..AL.QPV....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1751 score:126 alignment:3M1S[1,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGAG.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1809_005 score:86 alignment:3I14M1I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSVAAPSVFL..FPP..STNGN.LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1838 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCH..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3909 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DWH..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2286_003 score:42 alignment:3I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDHDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_091 score:101 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..N...VS...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1877 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYC..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3346 score:42 alignment:2I7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGDSD..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2321_005 score:43 alignment:2I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2791 score:39 alignment:1I7M5D1S[1,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GEAFVVGV......VAGEF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3101 score:43 alignment:1I7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDLH..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2760 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCP..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C971_019 score:43 alignment:2I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYDDD..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1518_006 score:42 alignment:3I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ADDDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C359 score:44 alignment:3I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLQV.S.YQV..S..PY..Q...VS...NLNSG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2059_006 score:42 alignment:3I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGWDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1070 score:42 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSA.S.DDF..L..LP..S...AS...DDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1297 score:46 alignment:8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGD..HV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_371 score:42 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSA.S.DDY..L..LP..S...AS...DNF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C934_002 score:75 alignment:2M1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFHQDYSS.PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1793_006 score:43 alignment:2I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGDSD..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3416 score:45 alignment:1I8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCQP..LV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1754_006 score:44 alignment:2I11M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MTPA..LQPA..LQ.PAL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2511 score:48 alignment:2I5M2I3M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPP....ET..LS.RN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C817_006 score:40 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.SVLE.EEQEDPYLNNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2080_004 score:63 alignment:1I8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PDPA..LQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C491_002 score:116 alignment:1M1S[2,2]13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGPQ.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C460_018 score:92 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..N...VS...RS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1157 score:49 alignment:2I8M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLQ..V..S..LM.SDV...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1968_002 score:44 alignment:1I5M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CDPA..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2010_006 score:44 alignment:7M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDP..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1420_007 score:118 alignment:2M1S[2,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPAN.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C598 score:49 alignment:2I8M1S[2,2]1S[2,1]1M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLQ..V..S..LF.SDL...PYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3272 score:46 alignment:8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DWH..AV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C111_002 score:44 alignment:9M2D5M unique:False
~~~~~~~~~~L.FLVVT.PQM....TLTCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C839_009 score:116 alignment:13M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q...AT...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1797_006 score:107 alignment:12M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KFGQ.S.PQL..L..LY..Q...SA...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C331_007 score:92 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LN..V...YS...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3399 score:52 alignment:2I6M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGEE..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C929_005 score:47 alignment:7M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ED..DV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C370_009 score:39 alignment:2I6M3D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVSS.SLSL...QDKTGF~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2140 score:44 alignment:2M1S[2,3]9M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.QAAV..T..AY..H...AS...QAAGS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2131 score:36 alignment:3M1S[2,2]4D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V...L..V....VA........TNAAVT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1673 score:81 alignment:1S[2,2]13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AYASS.YLSLTSSDWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C858 score:42 alignment:11M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTFD.RFSPELQASFQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C748_006 score:73 alignment:6M1S[1,2]4M2I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PGAL..L..LGLGQ...HV...D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1534_008 score:47 alignment:7M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EH..CV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1564_009 score:108 alignment:3I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQSAPSVFL..FPP..SDEK..LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3729 score:48 alignment:9M2I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QASSG.S.PGLVRL..LA..Q...AT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_212 score:98 alignment:4I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMSPGQ.S.PQL..L..LY..Q...TS...AR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C741_005 score:44 alignment:2I5M1S[2,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGSASVVSADL.DTKYER~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1264_003 score:117 alignment:3I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MSCPGQ.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C765_012 score:37 alignment:7M3D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLLNF.PL...APS.KS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C182 score:44 alignment:1I12M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LCVVLHE..EPVSEKVTK~~~~
>C468 score:96 alignment:1S[2,2]2M1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPQ.SKPQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1288_006 score:114 alignment:4I5M1S[1,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMSPGQ.S.PGAL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1774 score:93 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YAASS.YLSLTSSDWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2250 score:99 alignment:3I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQSAPSVFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C248_007 score:55 alignment:9M1D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.YNGMVTHE...SKEEK~~~~~~~
>C2416 score:37 alignment:7M2D6M unique:False
~~~~~~~~~~~~~~~~~~~GE..EAVPS...SGM.SGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1739 score:37 alignment:11M2D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAS.G...PPVSELL...TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C742_003 score:41 alignment:1I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVVVAG.EFDQGSKSTD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C378_004 score:42 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLD.DAEGVGHADDP.D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C462_007 score:40 alignment:1I1S[2,1]1M1S[2,2]2M1S[1,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NQVSLSLVAAT.A...SQDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C197_007 score:55 alignment:12M1D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.YSCQVTSE..HKE.EK~~~~~~~
>C440_002 score:42 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..LP..S...AE...DPSQVVEE.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C150_019 score:75 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY..G...SS...VGR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C889_019 score:117 alignment:3I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TMSPGQ.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1275_004 score:107 alignment:3I11M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TMSPGQ.S.PQL..L..LY..Q...GT...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C189_012 score:64 alignment:7M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.YSCQVT.E..HSKEEK~~~~~~~
>Combined_657 score:38 alignment:3M1S[2,1]10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAL....Q.PA...L..N..P..VL.SGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1365 score:99 alignment:3I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQSAPSVFL..FPP..SDQE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C651 score:116 alignment:4I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMSPGQ.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2589_002 score:55 alignment:2I5M2I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPP..EGKE..LS.G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1676 score:97 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YAASS.YLSLTDSEWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C335_016 score:43 alignment:3I7M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~LQQASLPLL.SNT.NHGD.EE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3902 score:44 alignment:1I5M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CE..HP.AL.....Q.PV...L..S..G..LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_658 score:53 alignment:3I5M1S[2,1]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGGLV.PAL....Q.PV...L..R..G..LS.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C746_006 score:42 alignment:1I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTNPRPVASS.QSSLPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1244 score:36 alignment:1I5M4D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVEL..DP......E..LQ.KVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1218_004 score:108 alignment:12M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGQ.S.PQL..L..LY..Q...AT...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1264_008 score:47 alignment:7M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EP..PC.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C851_018 score:115 alignment:3I5M1S[1,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MSCPGQ.S.PGAL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C668_011 score:36 alignment:3M1S[2,2]4D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V...L..V....AV........TNAAVT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3145 score:47 alignment:7M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EH..SV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C923_012 score:100 alignment:3M1D11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQK.KPGQ.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1541 score:120 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YAASS.YLSLTPEQWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1139_009 score:39 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.ASS....GS.PA...T..V..R..LL.VV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_044 score:112 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C874_004 score:65 alignment:2I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WVFGGGT.TLT.VL.GQPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2472 score:61 alignment:2I5M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPP..NSEE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1320_003 score:44 alignment:2I4M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASLP.AL.....Q.PV...L..S..G..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3132 score:102 alignment:1S[2,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AN.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3184 score:46 alignment:2I5M1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....Q.PV...L..S..K..GL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2021 score:39 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AE..LR.ALV....NG.MV...Q..Q..T..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1154_004 score:76 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.GPR..Y..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C996_002 score:75 alignment:12M3I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PEL..L..LS..HKPPAS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1084 score:47 alignment:1I6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ME..HV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3103_002 score:39 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RVNVPAL.Q...SPVLSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2523 score:43 alignment:4I3M5D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QCHDE..LQ...........PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C588_005 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..CH.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1830 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..RV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1009 score:39 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~FSQLDR.SYP.SLLC.AL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1826 score:46 alignment:5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..WP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C895_005 score:70 alignment:2I5M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPP..SDQE..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3269 score:39 alignment:1S[2,2]12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NT.NLWD.RNDGYLYY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1760 score:76 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.GRP..Y..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C583_002 score:51 alignment:2I14M unique:False
~~~~~~~~~~~KLLLSS.PAA..PATLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1083 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..SV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C949_007 score:41 alignment:8M1S[1,2]1M1I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPENYPGQGLSCYVCR~~~~~~~~~~~~~~~~~~~
>C474_012 score:38 alignment:5M1D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASL.PL.LTEECKKY~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C116 score:100 alignment:11M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY..Q...AT...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1251 score:49 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...AS...LPLGQTPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1107 score:41 alignment:5M3I2M1S[3,2]2M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...ASLPLTGTNQPR.D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2283_005 score:45 alignment:1I5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CE..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C779_004 score:49 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...AS...LPLASQPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C400_006 score:94 alignment:1S[3,3]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SG.Q.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2250_004 score:57 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..CP.ALL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1746 score:44 alignment:2I4M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASLP.AL.....Q.PV...L..S..G..LM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2525 score:46 alignment:5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..CP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1728_003 score:53 alignment:2I3M2D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.M......Q.PV...L..S..G..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3821 score:37 alignment:1S[2,2]4M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGP....AW.T....L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2647 score:49 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...AS...LPLANTPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2004_006 score:44 alignment:2I4M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SALP.AL.....Q.PV...L..S..G..LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1736_013 score:45 alignment:1M1S[1,2]4M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGGP....AW.T....L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2568 score:48 alignment:3M1S[2,1]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APG....Q.WT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C377_024 score:44 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QSNQGYLQSN.QLTM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_565 score:46 alignment:2I6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE..HV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C685_009 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~ASLPLL.SNQ.SCKK.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1683_009 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..GH.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2891_002 score:45 alignment:1I5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WE..HP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1944_009 score:39 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~NGE..EAVLVPG.SSM.PW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3810 score:49 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...AS...LPLATNPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3844 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..TV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_546 score:44 alignment:2I4M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASLP.AL.....Q.PV...L..S..G..LH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_563 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..DV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2134_007 score:44 alignment:2I4M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGLP.AL.....Q.PV...L..S..G..LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3047 score:39 alignment:13M1S[1,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTGYVPAL.QPVLSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1223_009 score:42 alignment:6M1S[2,2]1M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGY..LL.QGS....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C901_008 score:39 alignment:1M1S[2,1]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K....Q.DV...L..E..D..LE.SVG...K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_620 score:45 alignment:1I5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GE..CP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_387 score:48 alignment:6M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..YC.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C573_013 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..LD..M...EL...MGASGVSS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1156_002 score:70 alignment:2I5M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TKPSVFPSVFPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C962_013 score:39 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLP.CPA....LQ.PV...L..S..G..LH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C212_025 score:92 alignment:1S[2,2]8M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AN.S.PQL..L..LY..Q...GT...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C185_016 score:88 alignment:1S[2,2]9M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QG.S.PQL..L..LY..Q...AT...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1664_011 score:45 alignment:1I5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YE..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_445 score:45 alignment:1I5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ME..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1057_010 score:44 alignment:2I2M1I12M unique:False
~~~~~~~~~~~~~ESVTRPPE..QASLPLL.SN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1271_012 score:39 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~NGE..EAVLVPG.SWP.SM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3414 score:42 alignment:3M3D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS......SGSPA.RLT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1900_006 score:61 alignment:2I5M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLPSVFPSVFPP..SDQQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2052 score:82 alignment:2M1D2M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QK.KPAN.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_155 score:85 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PGR..Y..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C233_026 score:80 alignment:2M1I5M1D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLS.PQL..L...Y..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C50_024 score:38 alignment:3M3D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS......SGSPV.RSV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1795_006 score:40 alignment:14M unique:False
~~DWVVQQTLG.RLPGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3281 score:38 alignment:3M3D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS......SGSPA.RTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1517_007 score:46 alignment:2I9M1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ADLL.HDD...LPGALSELS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2019 score:55 alignment:5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..LP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C653_004 score:37 alignment:7M2D1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AS.G...PPVT...DLLTK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C138_010 score:63 alignment:3M1D2M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQK.KP.Q.S.PQL..L..G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_850 score:46 alignment:5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..TP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_172 score:61 alignment:2I5M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TKPSVFPSVFPP..SNEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C133_019 score:38 alignment:3M3D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS......SGSPL.RTA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1759_002 score:53 alignment:2I4M1D1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSLP.AL.....Q.PV...L..S..G..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C415_002 score:40 alignment:3M1S[3,3]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KS...APSASML..PSA..SD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_879 score:45 alignment:1I5M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DE..VP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C369_019 score:39 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGSGP.HTG.PLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_957 score:46 alignment:2I5M1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....Q.PV...L..K..S..GL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C576_017 score:38 alignment:10M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.ASS....GS.PA...L..R.....LL.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2760_004 score:43 alignment:4I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YMPVLQ.S......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2140_009 score:42 alignment:5I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QPQPALQ.L......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3181 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLQ.PCP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1787_013 score:45 alignment:2I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.W......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2138_004 score:55 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AMALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2867_004 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2070_009 score:54 alignment:2I2M1D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ..NL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2163_006 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PAL....QA.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3098 score:48 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2853_003 score:46 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALPALQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2199_006 score:49 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3202 score:46 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVPALQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1950 score:48 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1336_011 score:100 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYSSPLTFGAGT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2994_003 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLY.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2898_002 score:40 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLD.HPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1883_009 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLP.CPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1967_011 score:47 alignment:3I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPALQ.WPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1838_007 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LT.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1637_009 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.GVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1594_012 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3184 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALY.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1108_005 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QPL..NVE..LDPE..LQ.KVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1784_009 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SALP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3250 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....Q.PV...V..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2231_004 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLQ.PVL....QW.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2818_004 score:40 alignment:1S[2,3]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  GAL.QPA....LN.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3168 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLN.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1515_007 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QALQ.LCP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1500_009 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVLS.SRV....NW.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1142_014 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.MG.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3227 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3156 score:54 alignment:4I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1636_006 score:43 alignment:4I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALPVLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3201 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PMP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1009_013 score:38 alignment:4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LP.AL.....Q.PV...V..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2975 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PVL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2914_005 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALN.FPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3183 score:57 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C274_010 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VRP..FPP..VSEL..LK.T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3796 score:34 alignment:5M5D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~PATLS.......SLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2165_006 score:43 alignment:4I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NMPALP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2738 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MPLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3271 score:45 alignment:2I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.M......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1730_006 score:44 alignment:3I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPQLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2727_004 score:52 alignment:6I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2686 score:42 alignment:5I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CPVPALQ.P......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1980_009 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVLW.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1427_007 score:82 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYSSPLTFGAGT.KLE.KL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1050_006 score:40 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TQ.PQL..L..LY..G...SP...SSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2556 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....QW.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1770_005 score:40 alignment:1I2M2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SV...LGDV..G..LT.EVG...YERA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1800_007 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.YPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2260_005 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.LPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2509 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NPLP.ALQ....MQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1811_014 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2624 score:39 alignment:5M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NG....AW.T....L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1837_008 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QALQ.WPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2684 score:57 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1890_010 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLY.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1967_012 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2101_006 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PAL....QW.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C879_016 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QASGS.S.PAT..L..LV..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2688 score:40 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLN.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3049 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLQ.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2768 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLC.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2059_008 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2903 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGLP.ALQ....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1430_010 score:46 alignment:2I5M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSLK.KLN.....AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2991 score:73 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RYAAQ.Y.LLL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2148_006 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLP.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2872_003 score:53 alignment:5I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQSLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3251 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLC.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2803_002 score:55 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1702_008 score:39 alignment:7M1D5M unique:False
~~~~~~~~~~~~~~PYN.FCL..P.SLSCR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2762 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGLH.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3042 score:57 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1125_007 score:71 alignment:1S[2,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AN.S.PQL..L..LY..Q...WT...K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2537 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2755 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.SAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1266_004 score:91 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SREEC.S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3228 score:57 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.APA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C531_015 score:40 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTMR.SVT.AM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3144 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.WQP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2802 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PPG....EV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2691 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.FPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2282_004 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALN.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1764_015 score:44 alignment:3I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSGLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1895_014 score:46 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVPALQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2077_007 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3414 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPLQ.YVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1616_003 score:45 alignment:2I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPLQ.M......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_624 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASLM.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1928_002 score:65 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PNL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_594 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DPLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1847_010 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PVL....QW.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1931 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVLM.PAL....QV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_523 score:55 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_524 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1861_004 score:37 alignment:2I5M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPLQ.MGH.......PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_623 score:45 alignment:2I2M1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQPALQ....SR.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_490 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KALV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_489 score:57 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_488 score:53 alignment:2I2M1I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQPALQ....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2069 score:47 alignment:7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LR.AQP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1836_011 score:57 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_672 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GCLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2984 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.VAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_525 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1731 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PAL....QR.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1982_002 score:46 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVPALQ.PAL....QM.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2685 score:48 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1230 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2808 score:45 alignment:2I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.Q......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1923 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2017 score:46 alignment:1I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2644 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2006_002 score:30 alignment:3M6D4M unique:False
~~DLV.......SLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C592_013 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.ASS....GS.PA...T..V..R..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_677 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LM.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1955_003 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPLQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_659 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.HLQ....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1841 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2007_003 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.MVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1983_004 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.GAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1957_002 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PLQ....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2690 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1945 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LMLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2977 score:46 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPVLY.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3048 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1668 score:41 alignment:13M unique:False
~~~~~~TQCPA.LQPVL.SGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1085 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_882 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1926 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PVL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1899 score:43 alignment:2I5M2I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PMPVL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_287 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_343 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLY.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1833 score:46 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPLNQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_342 score:49 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PDP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_341 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_562 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_395 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_278 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.CL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1916 score:46 alignment:1I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_334 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_325 score:48 alignment:1S[2,3]3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  AGL.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_550 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1515_011 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1413 score:39 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LFL..V..S..LG.DDL...YLGGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C116_004 score:39 alignment:3M1D9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPE.VDV.CTAKPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C24_002 score:38 alignment:1M1S[2,2]1M2D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLSA..AD.K...GNVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_188 score:39 alignment:5M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPVED.V.CTAKPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2068_013 score:55 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_245 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PMP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2018 score:44 alignment:3I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPVLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_734 score:46 alignment:1I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2332 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1879 score:45 alignment:2I2M1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQPALQ....DK.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1640_012 score:37 alignment:2I5M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.MQM.......PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_472 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.SL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_405 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLQ.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_447 score:45 alignment:2I2M1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQPALQ....PV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_446 score:48 alignment:1I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2150 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.LPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_402 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....QK.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2131 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGLQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_444 score:47 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALN.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_561 score:55 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_520 score:45 alignment:2I2M1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQPALE....DK.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1226 score:37 alignment:2I5M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.MQD.......PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_391 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.ML.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_475 score:45 alignment:2I3M2D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.M......Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_587 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2820 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.GPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3155 score:54 alignment:4I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVPALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_660 score:56 alignment:2I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2468 score:38 alignment:6M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.GMP....ALQPV...L..S..G..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1031 score:54 alignment:2I2M1D2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ..NL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3279 score:46 alignment:3I5M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APVLY.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2605 score:37 alignment:1S[2,1]4M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~    Q.PV...L..V..L..GH.YQS...W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C405_005 score:72 alignment:3M1D3M1S[2,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQK.KPGS.Q.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3864 score:45 alignment:2I4M1D1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASLP.AL.....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1238 score:72 alignment:3M1D2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQK.KPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3195 score:45 alignment:2I7M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLQ.CVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1518_002 score:47 alignment:1I6M1D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALK.SALN....AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3010_002 score:46 alignment:2I1S[2,3]3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VR  AAV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3413 score:48 alignment:2I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPLQ.PVL....SQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2928 score:66 alignment:2M1D2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QK.KPAN.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_284 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.WVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1814 score:44 alignment:1I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ER.TDL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2982 score:38 alignment:3I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTMV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_283 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.MVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1542_013 score:38 alignment:3I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QSYV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2893_002 score:41 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AL..VQW..VDET..LA.AN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2038_008 score:40 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RAQ.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1553_011 score:44 alignment:4M4I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.CNDVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C432_008 score:59 alignment:5M1I3M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPDGRFS.SGY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_345 score:47 alignment:1I6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RQ.AVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2983 score:38 alignment:3I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AARV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_715 score:40 alignment:1S[2,1]1M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVSLQDKAS.G...F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1340_006 score:68 alignment:1I12M unique:False
~~NLVMTQTPK.FLLV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2549 score:48 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MGQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1355_007 score:41 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F.FVAPF.PLDFGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2066 score:48 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.AVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1502_007 score:48 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.ATP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_279 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.WPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1015 score:40 alignment:1S[1,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GA.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1816_010 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.CVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1828_008 score:40 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGQ.HPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2566_004 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2022 score:44 alignment:1I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CE.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1779 score:38 alignment:3I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QSFM.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_443 score:40 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGQ.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1885 score:59 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPD.GKEGYGY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1159 score:64 alignment:2M1D2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QK.KPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C690 score:59 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPD.GRYGTGY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_629 score:38 alignment:3I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GARV.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2971 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K....WN.QT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2749 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K....QD.WT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1167 score:76 alignment:2M1D9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QK.KPGQ.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2735 score:39 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~YNSLTLG.SYM.TLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_652 score:37 alignment:1S[1,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AA.LEP....VE.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3860 score:48 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C418_016 score:42 alignment:3M1S[3,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQKKPQPQ.G.SLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1464_004 score:35 alignment:6M2D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLD.LD..NTMR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1675_010 score:41 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KG....WG.ET...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2191_003 score:38 alignment:3I1S[2,1]10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PAL    Q.PV...L..S..P..VL.SGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C773_003 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PWQVTVQDKAS.F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1693_015 score:48 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2902 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.FVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C147_024 score:40 alignment:8M1D3M unique:False
~~~~~~~~~~L.SSPAT.TP...PAS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3203 score:40 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGQ.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1107_003 score:84 alignment:9M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PQL..L..LY..Q...AT...SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_383 score:40 alignment:1S[1,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AG.MPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2773 score:38 alignment:3I1S[2,1]10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PAL    Q.PV...M..V..P..VL.SGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2820_004 score:39 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QPV.LSW....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1757 score:96 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PQL..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_360 score:40 alignment:2I1M1S[3,3]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTAPSAVML..PSA..SD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2939_005 score:43 alignment:1S[1,2]3M3I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GA.KNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1467_009 score:74 alignment:7M1S[2,2]1M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DF...YPGAVSLAKW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1289_007 score:78 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VFL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1847_002 score:45 alignment:5I2M1S[2,1]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RVNVPAL....Q.PV...L..S..G..LR.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C763_005 score:55 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVPD.GKEGYGY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2622 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K....NW.QT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_880 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.PVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1571_010 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.YVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2900 score:59 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLSAVQAEDLAVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1879_006 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.VVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_478 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.YPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3209 score:49 alignment:1I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QP.AAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2035_008 score:48 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1144 score:40 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RGQ.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2062_007 score:48 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NTQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2048 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.MSP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2880_003 score:39 alignment:5M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AWP....ALQPV...L..Q..G..LS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3680 score:34 alignment:6M1D5M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGT.R.MTG.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1975 score:48 alignment:2I8M1S[2,2]2M unique:False
~~~~~~~~~~~~PEPVT.EPE..PVTVSW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C918_006 score:47 alignment:3I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NWHQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C377_004 score:39 alignment:5M1I7M unique:False
~~~~~~TQTMLNSLPSA.SD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_168 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DF...VPNSVSFSWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2295_005 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.RVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1111_003 score:75 alignment:1I5M1D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LS.PQL..L...Y..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3081 score:43 alignment:2I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGE.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1532 score:31 alignment:4M3D5M unique:False
~~~~~~~~~~L.LLP....GE..LAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C823 score:41 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL.DLSLDLAEVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_854 score:49 alignment:1I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2024 score:40 alignment:1S[1,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GA.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_554 score:40 alignment:1S[1,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AG.MPA....LE.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2660 score:49 alignment:1I4M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CQ.PAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2689 score:39 alignment:3I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVAQ.VPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3843 score:39 alignment:3I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QPVP.ALQ....PM.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2491 score:42 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K....DW.QT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_856 score:39 alignment:6M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.GVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C127 score:75 alignment:8M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGVPD.RFGSSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C340_011 score:40 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQ.T.VCL..C..LP..S...AS...D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C627_012 score:66 alignment:2M1S[2,1]2M1I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFQGTGKLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_638 score:35 alignment:2M1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFHQDYSS.PLTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1980 score:40 alignment:5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AWP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C108_003 score:52 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGVPD.RYQSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2644 score:40 alignment:2M1D4M1S[2,2]2M unique:False
~~~LV.TLTP.VTLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_955 score:39 alignment:1I1S[2,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGA.WT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_094 score:42 alignment:1M1S[2,1]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K....Q.TA...L..V..E..LL.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2920 score:36 alignment:8M1D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..Q..L...Q...A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2326_003 score:41 alignment:2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GYAMA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_151 score:38 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KT...QLPEVFL..TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2741_005 score:37 alignment:3I3M1S[2,2]2M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLDLSLDLAE.VGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1018 score:38 alignment:1D10M unique:False
~~ LVMGQVQQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3181 score:34 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.LVG.LV.GQLKG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1873_012 score:76 alignment:1S[2,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSGYGTDF.TF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1935_004 score:39 alignment:1I3M4I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VADHVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C28_004 score:31 alignment:1I3M3D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NLSL...QDKSA~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1402_004 score:48 alignment:2I7M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQL.S.PQL..L..G...Q...AS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_984 score:70 alignment:2M1S[3,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPSG.Q.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1552_009 score:76 alignment:2M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPQG.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C298_013 score:67 alignment:3M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QKPQG.S.PQK..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3945 score:39 alignment:4I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CPVPALQ....PV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1947 score:39 alignment:4I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NHVPALQ....PV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1185 score:42 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FCH.QDYSS.PLTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1870_015 score:88 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGSGYGTDF.TF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1334 score:78 alignment:2M1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFQGT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2041 score:78 alignment:4M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAAS.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2819 score:39 alignment:3I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AWVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_952 score:41 alignment:2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MPAPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C129_020 score:38 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGSFR.DGS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_630 score:36 alignment:8M1D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..L..Q...Q...A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2998_002 score:38 alignment:2I4M1D1S[2,1]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVLQ.AL.....Q.PV...L..S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2043_005 score:48 alignment:1I4M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QAG.PWT..L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1101 score:88 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C75_007 score:38 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PNK..A..QA..Q...A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2975 score:39 alignment:4I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CPVPALQ....PM.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2198_005 score:36 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~QSLTNN.LTL.TLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3570 score:68 alignment:2M1S[2,1]1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFQSA.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1025 score:40 alignment:2I1S[2,1]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QP    Q.WT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C7_002 score:34 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLGTAD.K...GNVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2692 score:40 alignment:2I5M1S[2,1]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....Q.PV...L..S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_340 score:39 alignment:1I5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CAVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C209_018 score:37 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QPA.TPAGTGYGS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1858_006 score:38 alignment:4I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WAPVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2526 score:40 alignment:5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ACP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1564 score:32 alignment:2M1D8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RV.HP..VSTMLK~~~~~~~
>C136_003 score:52 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGVPD.RQYSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1457_009 score:50 alignment:2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGV...L..V..G..LV.SDR...GM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3180 score:42 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ....PL.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_484 score:39 alignment:1I5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CAVP....ALEPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3924 score:39 alignment:3I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ATVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2580 score:76 alignment:4M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KQKPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1654_009 score:41 alignment:2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SCAPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1336_007 score:42 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GG.SL...L..A..S..LL.STF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2761 score:36 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~NSLTLD.HEP.TLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C86_012 score:36 alignment:4M2D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KL...K.GEML~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1906 score:43 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CH.QDYSS.PLTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1882_016 score:40 alignment:2I1S[2,1]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PQ    Q.WT...L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1972 score:60 alignment:1I11M unique:False
~~NLVMTQTPK.FLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1556_005 score:49 alignment:2I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALNW....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3069 score:38 alignment:3M1S[2,1]4M2I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAL....Q.PV...L..QLSG..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1494_014 score:47 alignment:1D10M unique:False
~~ LVMTQQAQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1547_004 score:34 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VFL..FPL..YFAM..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1971_009 score:39 alignment:2I3M3I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSADVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3301 score:37 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTGR.MTA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2068_006 score:40 alignment:5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2619 score:40 alignment:3I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGPAPA....LQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2880_004 score:40 alignment:1I3M3I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RADVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1957_017 score:39 alignment:1I4M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AQG.PWT..L..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C751_016 score:41 alignment:1I4M1S[2,1]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLTVGQN.KSL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2222 score:43 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ANP....AL.QV...R..Y..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2149_003 score:38 alignment:2I5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~LSSLSNRLSSP.ATL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1266_005 score:46 alignment:1I11M unique:False
~~NLVMDVTPK.KLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2693 score:38 alignment:4I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ACHVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_330 score:39 alignment:3I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ACVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C311_012 score:33 alignment:1S[2,1]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVTVQDKTG.F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2418 score:40 alignment:1I4M1D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPSVF...FRP..SKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C137_008 score:33 alignment:1S[2,1]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~    Q.NA...L..D..G..GL.SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1921 score:40 alignment:5M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AHP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C648_006 score:37 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAG.PP...V..S..E..LL.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2753_003 score:46 alignment:3M3I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AWKPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2747 score:37 alignment:3M1S[2,2]1M1I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NA....AP.GVD..L..T..Q..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1130_002 score:42 alignment:10M1S[1,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SE.YHSLLNENMA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1830 score:38 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PTL..L..KS..P...AT...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C623_012 score:37 alignment:1I11M unique:False
~~~~~~~~~~~~FLPGP.KGR..PSTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2670_003 score:44 alignment:2I7M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~YNSLTLD.SY.NTLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1380_005 score:39 alignment:1I8M1I3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~PSLNDD.SSYPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1961_008 score:39 alignment:3I3M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AMVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C106_008 score:33 alignment:1S[2,1]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~    Q.NA...L..N..G..GL.SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1306 score:35 alignment:1I6M1I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKEAAESLYQSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C936_014 score:34 alignment:1I10M unique:False
~~NLVVNMTPK.FL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3636 score:51 alignment:2M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FL...PP..SDEQ..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2161_006 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TRNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2689_002 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3141 score:30 alignment:2I3M2D1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.M......Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3257 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KDHVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1895_002 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CDVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_947 score:40 alignment:1I4M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WNP....ALEPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_669 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGWPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_437 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DMVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1838_002 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NTVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C115_020 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTNR.VM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C5_005 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FSSSSGYPTMR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3582 score:61 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3604 score:37 alignment:2M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FS.TDFGTDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_337 score:41 alignment:2I5M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ.PAL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C552_014 score:33 alignment:1I4M1S[2,1]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MQ.PAL....Q.PV...L..S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C308_010 score:32 alignment:1I6M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YEE..LQ.QT.....AG.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_442 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_430 score:40 alignment:1I4M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WNP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1527 score:62 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1969_009 score:41 alignment:2I5M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QALQ.PAL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2547 score:32 alignment:1I6M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YEE..LQ.LT.....AG.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C303_013 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PQL..E..LV..Q...VP...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1283 score:39 alignment:2I5M1I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLG.NV...L..VV.G..LL.RR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1463 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..V..N..EL.TEF...AK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1662_013 score:44 alignment:3I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RYCDL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_185 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..H..G..LL.SNT...HR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1709 score:42 alignment:2I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLG.NV...L..V..G..VL.LR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_107 score:34 alignment:1S[2,1]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~    Q.TA...L..V..E..LL.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_208 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..V..N..QL.TEF...AK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1946_016 score:39 alignment:3M3I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.VVYHTL..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1799_010 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCTPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C73_003 score:39 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..G...PS...DSASR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1996 score:80 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KLE.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_403 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VRNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_285 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2796 score:31 alignment:1I4M1D1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CLP.AL.....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2165_007 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1184_012 score:51 alignment:1I2M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLPAN.S.PQL..L..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1646 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSVQ.YLPD.WDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C468_020 score:41 alignment:3I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLPLL.SDT...DPGHM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3223 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYDVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2993_003 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FGNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C148_015 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSNTDEYMKY~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3825 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S...TSTPGVFS.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1498_012 score:79 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTFGAGT.KLE.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_476 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PWSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3075 score:56 alignment:1M1S[2,2]1M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PQG.SKPQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_514 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDDHPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3158 score:41 alignment:2I5M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AALQ.PAL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2170_005 score:39 alignment:2I2M1D2M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQ..NL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C227 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSD.SDDKKYW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_628 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2171 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~MPVP.ALQ..PVSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1073_013 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LT.NDNLNTLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3605 score:68 alignment:6M1I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGTGKLE.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2966 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGCPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_496 score:37 alignment:1S[2,1]1M1S[2,2]1M1S[1,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVSLQDSKAF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_420 score:61 alignment:1I10M unique:False
~~NLVMTQTPK.FL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1737_007 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLGD.SVTLLT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C918_015 score:39 alignment:10M unique:False
~~~LLATLTPA.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1015_016 score:68 alignment:7M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KEL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2023 score:40 alignment:3I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DMPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1710_011 score:40 alignment:3I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DPPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1258 score:61 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSGQ.K.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C549_009 score:70 alignment:3M1S[2,1]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGQT.KLE.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2312 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTGR.MA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C255_022 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QEL.QLTAGRGH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2070 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTGR.AM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_666 score:52 alignment:1I10M unique:False
~~NLVMTQTPK.LF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C772_014 score:61 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL..FPP..SDEQ..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_678 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NRVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3427 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DV...G..V..L..LT.RDY...Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1702_006 score:40 alignment:1I4M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MNP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C928_008 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSMVGV.QQTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C969_012 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QV.SLQD.SLTGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3205 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGMPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2324_004 score:40 alignment:3I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NYPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2613 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AW.PA...L..Q..P..VL.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_848 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DHVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2021_006 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DTMPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2298_005 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCYPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3221 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DTVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_823 score:47 alignment:2M3I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NKPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1884_008 score:40 alignment:3I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NCPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2546_006 score:43 alignment:7M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.MT...L..V..G..L.VTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2213 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVTAYNNM.QSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_833 score:40 alignment:3I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2183_005 score:40 alignment:1I4M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NNP....ALQPV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C852_010 score:32 alignment:1I5M1D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~DLSGP.G.Q.SLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2613 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C937_003 score:34 alignment:1S[2,1]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~    Q.TV...A..V..G..VL.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1518_008 score:46 alignment:4I5M1S[3,2]1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYSSPLTFGTQ.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3724 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTAYNNM.QSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1714_008 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DPVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1962_004 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDRVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2960 score:47 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSPCHNL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1241 score:33 alignment:6M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EE..LQ.LT.....AG.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1839_004 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ESH.SLLN.ENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1864 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NPLLSW....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2073_011 score:47 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPVLSNL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2248_004 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGHPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_568 score:34 alignment:1S[2,1]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVTVQDKSA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1877_016 score:35 alignment:10M unique:False
~~~~~~TCTVL.SLSGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_566 score:37 alignment:4M2D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KL...K.GEM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2313 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTGM.RS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C663_006 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GCDHPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1701_011 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G...SDVVVAG.EF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3422 score:38 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTVR.EM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_883 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RVNVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C28_015 score:34 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ELGHLQGKEH~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1946 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDCHPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C347_014 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSK.YNSLTLNN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C55_013 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LC.ANK....EG.SK...G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_555 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NCVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2476 score:38 alignment:1I10M unique:False
~~ALVMGQVQQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2440_002 score:42 alignment:2I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLG.NV...L..V..G..RL.VL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3154 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NYPVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2546 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGGVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2741_002 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGSHQL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1452_010 score:38 alignment:4I7M1D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYSSPLTFSAQ..KL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_655 score:39 alignment:4I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDCPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_892 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S...TSTPGVAY.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2587 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EL..LQ..Q...VD...TTRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1477_005 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CDPVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C92_025 score:43 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTGR.SM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3100 score:38 alignment:5I2M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGFVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C98_018 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~LCE.DNQ.SLSK.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C209_016 score:34 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EEL.QLTAGRGH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1715 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPW.SLLD.QNW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C621_020 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SCTVTLS..GF~~~~~~~~~~~
>C738_005 score:44 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_815 score:48 alignment:1S[1,2]1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3702 score:35 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTWR.G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1256_015 score:34 alignment:1I4M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQ.PAL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3597 score:60 alignment:1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSGYGTDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2268 score:31 alignment:1S[3,2]4M1S[1,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNTVQLAVA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1240_008 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DV...G..V..L..LL.NDT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1569_005 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~EPAT.GGK..PAM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2009_009 score:38 alignment:6I1M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KWMVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2216 score:44 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPGQ.S.SLD..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C777_008 score:34 alignment:1I1M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPAN.S.SLD..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1605 score:72 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..L..LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1280_010 score:42 alignment:6I1S[1,2]1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPCPCCGL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C91_012 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSLDDKDSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1865_011 score:41 alignment:4I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APVVAAT...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1098 score:60 alignment:2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1014 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SWL...K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1132 score:39 alignment:5I1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PMPAL    Q.PV...L..S..G..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1851_015 score:41 alignment:3I1M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KTHL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1515_009 score:49 alignment:2I6M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTSGSGYFDTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C920_016 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLD.LDSRQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1629_004 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL.QDF...FDGR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3896 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLD.LDNRT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1994 score:53 alignment:1I9M unique:False
~~NLVMTQTPK.F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1474 score:40 alignment:2I5M1I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLG.NV...L..VV.G..LL.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C34_016 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSLNDELSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_849 score:48 alignment:5I1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MHPAL    Q.PV...L..S..G..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1425_005 score:58 alignment:1I4M2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPQL..LSALY..Q...AS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C990_006 score:51 alignment:3I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVPTK...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2982 score:41 alignment:3I1M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGLY....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3233 score:42 alignment:3I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVSKS...LAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3686 score:34 alignment:2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ATGTGT.RLE.GM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_830 score:39 alignment:5I1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MHPAL    Q.PV...L..S..G..LS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3273 score:43 alignment:4M1D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...A....TRYS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C972_015 score:40 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLD.LDTRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C809_008 score:44 alignment:1I9M unique:False
~~~VLMTQTPK.FL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_799 score:31 alignment:9M unique:False
~~~~VMGQVQQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3170 score:39 alignment:5I1M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KMVPAL....Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1616_009 score:72 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_601 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..Q..LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1267 score:41 alignment:4I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVNKLT...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2696_002 score:32 alignment:1I1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGA.WT...L..V..G..LV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1146 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SDT...DPGHM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C867_004 score:41 alignment:4I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTHPALLFGTGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1785_012 score:35 alignment:4M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.VRL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C529_018 score:51 alignment:3I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVNKT...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1061_013 score:60 alignment:7M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSLTPEQKW~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C44_013 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDQ..L..RQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C516_006 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RSDKS..LA.ALK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3076 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V...L..V..G..LV.MSV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2879 score:54 alignment:1D8M unique:False
~~ LVMTQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C487_008 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLD.LDSQR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2914 score:33 alignment:5M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSLNTQESK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1509_004 score:62 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL..FPP..SDEQ..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C587_014 score:36 alignment:9M unique:False
~~DFVLTQSPH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3058 score:38 alignment:5M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...AS....RYT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C625_019 score:48 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTDFTGVPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1567_009 score:33 alignment:5M1I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.SLPSASDDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1665 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL.QDF...FNGR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C277_007 score:34 alignment:1I7M1S[2,1] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YEE..LQ.QTR....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2784 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LS...TAASFVFK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1827_002 score:48 alignment:5I1S[2,1]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VCPAL    Q.PV...L..S..G..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_543 score:42 alignment:2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFSE.SLLS.EDW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1174_005 score:36 alignment:1I1S[1,2]6M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGLASAVCD.FR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1948_010 score:30 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EL.KLLE.SEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1297_005 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.PLLH.TVSG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C489_007 score:62 alignment:2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPAN.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1908 score:34 alignment:2I9M unique:False
~~~~~~~~QLL.SLQDT.KGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2426 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLAVYFCH.Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C851_015 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GS.L.NEL..L..TY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C564_012 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGNYAM.QSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3189 score:34 alignment:1I4M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MQ.PAL....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3710 score:35 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTQR.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1589_010 score:54 alignment:3M1S[3,3]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.LPQ..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2386 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLVYPWT.QR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C35_020 score:34 alignment:2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QASSGS.PSVRV~~~~~~~~~~~~~~~~~~
>Combined_2364 score:35 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGTGR.W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2486_002 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SLW...K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1626 score:39 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPLDPVAGY.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C588_003 score:36 alignment:9M unique:False
~~~~VVTQHQV.SL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1296_012 score:41 alignment:4I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVSKSV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C614_016 score:34 alignment:1I7M1S[2,1] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YEE..LQ.LTR....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2867 score:34 alignment:2I9M unique:False
~~~~~~~~~~GGSLTST.PGV..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_350 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..L..QQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C481_005 score:37 alignment:1S[1,2]1M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLPQG.S.PQA..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3619 score:72 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAGT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C111_026 score:35 alignment:4M1S[2,3]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSTASGLSTA~~
>C127_009 score:40 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~E..PATGSFR.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C867_003 score:41 alignment:4I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TYHPALLFGTGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C4_007 score:42 alignment:1I2M1S[2,2]4M unique:False
~~NLVTMQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3822 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3352 score:35 alignment:1I3M1S[1,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~ALSGLG.STA.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C836_015 score:37 alignment:8M unique:False
~~~~~~TQTPN.KLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3595 score:54 alignment:1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGGVPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3908 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MVVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C88_024 score:37 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AS...TAASFK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1071_012 score:52 alignment:1M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1601_019 score:35 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVSLD.RFSGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1514_015 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MGCPVL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3886 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGMPVL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3167_003 score:34 alignment:3I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALEV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1377_013 score:41 alignment:5I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASVGKTV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C785_019 score:44 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KASL...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C153_021 score:43 alignment:5M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...AS...RTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C199_018 score:38 alignment:1I6M1S[1,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~ALSGL.TSGA.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3512 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVGAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3861 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MGCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3494 score:41 alignment:4I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1963_011 score:64 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSLTPEQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2203_009 score:33 alignment:3I3M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVPALQ....Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1780_012 score:41 alignment:4I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVQL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C598_013 score:50 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ATGLPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1331_007 score:53 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSKL...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3803 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MTVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3575 score:44 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KTNV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1520_013 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F.QTLEQ.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C978_012 score:43 alignment:3I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAGSV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C322_024 score:37 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~GS..PASLRL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1851 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C353_012 score:40 alignment:1I8M unique:False
~~NLVNTETPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3037 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_842 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_834 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3905 score:43 alignment:3I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPLAQ.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_828 score:42 alignment:3I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_812 score:44 alignment:1I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3505 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLD.NDPV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C813_002 score:31 alignment:1I8M unique:False
~~~~~~~~~~~~~~~KT.GLK..PATL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_766 score:34 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVELDPELQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1987 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGRVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2540 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WPVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_881 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SHVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2623 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TWPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1456 score:31 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..VL.TGM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3807 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MGVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_671 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCSPVL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3456 score:31 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL..C..LP..S...AS...D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1182_003 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SPT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2522 score:42 alignment:4I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPRPAV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3453 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HMPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C187_009 score:37 alignment:8M unique:False
~~~LSCTQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1256_008 score:31 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL..C..G..LL.AER~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C354_010 score:45 alignment:1I8M unique:False
~~NLVNTQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1660 score:31 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.SLLE.EFR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1648 score:33 alignment:1I3M1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVVL..PFP..SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C253_010 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..LE..N...AE...CR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1368 score:43 alignment:2M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLS.PQL..L..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2905 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SMS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2832 score:64 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1311 score:34 alignment:2I3M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLLQEQGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2680 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GMVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1189 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1179 score:54 alignment:1S[2,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1161 score:55 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...AS...TRY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1135 score:34 alignment:3I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PALQV.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C8_003 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTNASQRPD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2978 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_648 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YHPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1414_004 score:31 alignment:1I8M unique:False
~~NLVMSELPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1032 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVRVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1821_002 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TMVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_286 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_398 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CPVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_335 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_844 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSGMPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2493 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SWL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_276 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_275 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_281 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HWPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_277 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_385 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MMVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_260 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_259 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SAM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_349 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..L..Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C197_002 score:36 alignment:1I8M unique:False
~~NLVMNHTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1731 score:36 alignment:1I8M unique:False
~~NLVMTNHPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_112 score:55 alignment:8M unique:False
~~~LVMTQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_244 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MPVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_282 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YFVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1853 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GHVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_404 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MFVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1225 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_441 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MYPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_439 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VCYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_432 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_515 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SMA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_483 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_622 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2324 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGWVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_728 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MHPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2114 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GCHVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_845 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CYPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_382 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGMPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_271 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1639 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SMG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1554_002 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSHCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_321 score:41 alignment:4I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_818 score:35 alignment:1I4M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..L.VTQG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_559 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GMPVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3906 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HYPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined score:54 alignment:1I8M unique:False
~~NLVMTQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C956_008 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2777 score:54 alignment:1S[2,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2809 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~THVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3229 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GRVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2669 score:43 alignment:2I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2199_004 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TYCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1924 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FMCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2574_004 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGFCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C286_012 score:32 alignment:8M unique:False
~~~~~~TPTPA.TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1653_006 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2626 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2536 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2620 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCYPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1974_008 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2568 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSYCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3182 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2913 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2818 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MCYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3044 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VWVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1968_005 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCYVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1419_005 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VMCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3196 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SHMVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2981_002 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VSMVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C517_017 score:46 alignment:2M1S[3,3]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAKG.TLE.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3100_005 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RGVVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C362_011 score:34 alignment:3I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MGDSGGPT.RVS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2860_003 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MHVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3879 score:35 alignment:2I8M unique:False
~~~~~~~~KTL.SVPVT.LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C394_014 score:31 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AADK....AK.LV...F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2901 score:43 alignment:2I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2881 score:64 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAGT.KLE.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3907 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SSM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2803 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SGM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C424_009 score:53 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VSKA...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C816_007 score:36 alignment:1I8M unique:False
~~~~~~~~LPL.SLNST.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2062_004 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SCMPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3177 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCSPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2531 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CCPVL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2070_005 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL..L..LT..A...AS...F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1402_006 score:40 alignment:5I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCPVL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2383_003 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2571 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2815 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MCCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2859 score:39 alignment:6I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GMCPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1854 score:38 alignment:7I1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGCVPAL    Q.PV...L..S..G..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1932 score:53 alignment:1I1S[2,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGSL...AAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1579 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LE.LQ.GPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1904 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LKAS...TLASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C557_013 score:38 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KLE.QL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3500 score:37 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..VL.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1667_008 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PV...L..Q..L..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C191_014 score:30 alignment:2I1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQAN.S.PEL..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2988 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~LSSR.QSF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C439_012 score:39 alignment:5M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPD.FR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C602_009 score:29 alignment:7M unique:False
~~~~~~TQTPK.LF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C116_009 score:31 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVTVQKDSA~~~~
>Combined_1592 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.SLML.SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1593 score:29 alignment:7M unique:False
~~~~~~~~~~L.SFPTT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1275_013 score:37 alignment:2I4M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFTGVPR.DF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3630 score:49 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFTGVPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1746 score:50 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTGVPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C537_009 score:28 alignment:1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SA.KLE.QL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3563 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGSNF.PL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C300_005 score:32 alignment:3I3M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AQKEE..LA.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3665 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLS.ELTK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_257 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLP..SHEE..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2775 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLAS...TLASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3667 score:32 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL..V..G..LN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C829_009 score:45 alignment:2I7M unique:False
~~QVVMTQTPK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3555 score:33 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3581 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QNSNF.PL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3207 score:47 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3499 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAL..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C94_017 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SNVHVGM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1124_010 score:56 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLTPEQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1154 score:56 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KLE.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1624_006 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL.W.HQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C411_004 score:31 alignment:2I7M unique:False
~~~~LATLTPA.TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3467 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q.SLLQ.PL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_454 score:51 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1198 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTWK..GSF~~~~~~~~~~
>C92_018 score:33 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDK..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2986 score:30 alignment:2I1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQAN.S.PER..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1759_012 score:37 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL..V..G..LN.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C194_022 score:32 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVAPAAKT
>Combined_1147 score:56 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...AS...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2625 score:35 alignment:3I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WQTL..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_891 score:30 alignment:2I1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TNAN.S.PER..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C89_015 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGMWGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2274 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V...L..H..G..HL.Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3544 score:50 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FTGVPD.RF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_548 score:37 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..V..G..LV.SW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_604 score:30 alignment:2I1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TDAN.S.PER..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1354 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLLL.SLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3054 score:27 alignment:1I1S[2,1]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L    Q.PV...L..K..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1903 score:38 alignment:7M unique:False
~~~~~~TQTPK.FL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C126_004 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KLK.PN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2501 score:27 alignment:1I1S[2,1]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L    Q.PV...L..K..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_067 score:42 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTGVPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1254_013 score:29 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YEE..LQ.LT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_010 score:29 alignment:1I6M unique:False
~~~~~~~~LPV.SLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C236_002 score:38 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DTFELSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1725 score:31 alignment:3I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAAGYDVEK~~~~~
>C510_009 score:27 alignment:2I1S[2,1]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL    Q.PV...L..K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3351 score:29 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLE.NK.LQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3357 score:28 alignment:1I3M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RV...L..V....VAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C69_020 score:29 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGTPD.RL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C162_007 score:38 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YGGVPD.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C14_016 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYGEGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2607 score:27 alignment:3I1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLL    Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_134 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DAAWYQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3027 score:27 alignment:3I1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLL    Q.PV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C124_002 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLQ...AL...TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3530 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TAL..V..E..LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3501 score:31 alignment:4I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VFPFAPEVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

Template Sequence

DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYQKQKPGQSPQLLIYQASTRASGVPDRFSGSGYGTDFTFKISRVEAEDVGVYYCMQRIEFPLTFGAGTKLEIKGQPKEAAPSVFLFPPSDEELQANKAGPVLVGLLSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS

Recombined Template REC-0-8_002

Consensus Sequence

Annotated Consensus Sequence

Annotated Consensus Sequence (TXT)

Preview

Sequence Consensus Overview

Sequence Consensus Overview (TSV)

Preview

Variant Graph

Higher Order Variant Graph

Depth of Coverage of the Consensus Sequence?BargraphThe depth of coverage reported is the sum of all positional scores for that position. This is reported with the same position numbering as the consensus sequence.

Bargraph

Depth of Coverage of the Consensus Sequence (TSV)

Preview

Scores

Length

Score

Matches

Unique Score

Unique Matches

Order

Alignment

Reads Alignment (FASTA)

Preview

Combined

Combined_010

C111_002

Combined_091

C116

C233

C359

C823

Combined_038

Combined_044

Combined_067

C598

Combined_225

Combined_3132

C723

Combined_171

C1045_002

C7_002

C73_003

Combined_188

Combined_112

C108_003

C124_002

Combined_1731

Combined_134

Combined_1751

C465

Combined_094

Combined_151

Combined_1532

Combined_208

Combined_155

Combined_212

Combined_107

C858

Combined_1673

Combined_168

C1085

Combined_172

Combined_1277

Combined_1709

C24_002

Combined_185

C116_004

C136_003

C182

C197_002

C236_002

C392_002

C440_002

C491_002

Combined_1463

C651

C900

Combined_1490

Combined_1546

Depth of Coverage of the Consensus Sequence